SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000032690 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000032690
Domain Number 1 Region: 119-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.46e-151
Family Calponin-homology domain, CH-domain 0.00000000489
Further Details:      
 
Domain Number 2 Region: 4-141
Classification Level Classification E-value
Superfamily EF-hand 5.06e-20
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000032690   Gene: ENSXETG00000014954   Transcript: ENSXETT00000032690
Sequence length 628
Comment pep:known scaffold:JGI_4.2:GL173325.1:69999:82255:1 gene:ENSXETG00000014954 transcript:ENSXETT00000032690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRQVTEEEMEELREAFHKIDADGNGFISLNELNDLFKAANLPLPGYRLREIIQDFME
TGDSNKDGKISFDEFTTVFHNLKSSDVAKTFRKAINKKEGICAIGGTSEQSSAGTQHSYS
EEENYAFVNWVNKALEKDQDCKHVIPMNPDTDDLFKAVGDGIVLCKMINLSVAETIDERA
INKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPHLVLGLLWQVIKIGLFAD
IELSRNEALIALLKDGESLEDLMKLSPEELLLRWANYHLENAGCNKINNFSSDIKDIRLL
IVVINNTKWQCNGIGGYNITLVCLTQEKEDLKRAECMLLQTEKLGCRQFVTATDVVRGNP
KLNLAFIANLFNKYPALHKPENQDIDWSSIEEQGETREERTFRNWMNSLGVNPRVNHLYS
DLSDALVIFQLYEKIKVPVDWNRVNKPPYSKLGENMKKIENCNYAVDLGKNKAKFSLVGI
AGQDLKEGNHTLTLALLWQLMRRYTLNILEDIGGGQKVNDETILTWVNETLKEAEKCSSI
SSFKDPKISTSMPVLDLIDAIQPGCINYDLLKTEDLDETEKLNNAKYAISMARKVGARVY
ALPDDLVEVKPKMVMTVFACLMGRGLKV
Download sequence
Identical sequences F7E7X1
ENSXETP00000032690 ENSXETP00000032690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]