SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000032738 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000032738
Domain Number 1 Region: 11-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.99e-80
Family Calponin-homology domain, CH-domain 0.0000874
Further Details:      
 
Domain Number 2 Region: 1328-1439
Classification Level Classification E-value
Superfamily E set domains 1.6e-36
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1531-1639
Classification Level Classification E-value
Superfamily E set domains 1.07e-33
Family Filamin repeat (rod domain) 0.00000298
Further Details:      
 
Domain Number 4 Region: 1421-1528
Classification Level Classification E-value
Superfamily E set domains 1e-31
Family Filamin repeat (rod domain) 0.0000484
Further Details:      
 
Domain Number 5 Region: 453-570
Classification Level Classification E-value
Superfamily E set domains 1.27e-31
Family Filamin repeat (rod domain) 0.00068
Further Details:      
 
Domain Number 6 Region: 1858-1952
Classification Level Classification E-value
Superfamily E set domains 1.8e-30
Family Filamin repeat (rod domain) 0.00000398
Further Details:      
 
Domain Number 7 Region: 1154-1262
Classification Level Classification E-value
Superfamily E set domains 3.18e-30
Family Filamin repeat (rod domain) 0.0000418
Further Details:      
 
Domain Number 8 Region: 744-866
Classification Level Classification E-value
Superfamily E set domains 1.2e-29
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 9 Region: 849-967
Classification Level Classification E-value
Superfamily E set domains 1.2e-29
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 10 Region: 1060-1152
Classification Level Classification E-value
Superfamily E set domains 1.33e-29
Family Filamin repeat (rod domain) 0.00000811
Further Details:      
 
Domain Number 11 Region: 668-776
Classification Level Classification E-value
Superfamily E set domains 1.53e-29
Family Filamin repeat (rod domain) 0.00055
Further Details:      
 
Domain Number 12 Region: 2045-2138
Classification Level Classification E-value
Superfamily E set domains 7.31e-29
Family Filamin repeat (rod domain) 0.0000226
Further Details:      
 
Domain Number 13 Region: 2317-2410
Classification Level Classification E-value
Superfamily E set domains 5.94e-28
Family Filamin repeat (rod domain) 0.00000622
Further Details:      
 
Domain Number 14 Region: 561-663
Classification Level Classification E-value
Superfamily E set domains 3.47e-27
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 15 Region: 2639-2729
Classification Level Classification E-value
Superfamily E set domains 8.67e-26
Family Filamin repeat (rod domain) 0.00000542
Further Details:      
 
Domain Number 16 Region: 2508-2599
Classification Level Classification E-value
Superfamily E set domains 1.2e-25
Family Filamin repeat (rod domain) 0.0000116
Further Details:      
 
Domain Number 17 Region: 274-369
Classification Level Classification E-value
Superfamily E set domains 3.54e-25
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 18 Region: 1628-1741
Classification Level Classification E-value
Superfamily E set domains 3.54e-25
Family Filamin repeat (rod domain) 0.0000668
Further Details:      
 
Domain Number 19 Region: 371-474
Classification Level Classification E-value
Superfamily E set domains 8.01e-25
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 20 Region: 2415-2505
Classification Level Classification E-value
Superfamily E set domains 9.34e-24
Family Filamin repeat (rod domain) 0.00000782
Further Details:      
 
Domain Number 21 Region: 1248-1346
Classification Level Classification E-value
Superfamily E set domains 4.74e-23
Family Filamin repeat (rod domain) 0.0000393
Further Details:      
 
Domain Number 22 Region: 2249-2330
Classification Level Classification E-value
Superfamily E set domains 1.27e-22
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 23 Region: 954-1057
Classification Level Classification E-value
Superfamily E set domains 2.01e-22
Family Filamin repeat (rod domain) 0.0031
Further Details:      
 
Domain Number 24 Region: 1794-1874
Classification Level Classification E-value
Superfamily E set domains 3.74e-16
Family Filamin repeat (rod domain) 0.0000679
Further Details:      
 
Domain Number 25 Region: 2002-2057
Classification Level Classification E-value
Superfamily E set domains 0.00000000000153
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000032738   Gene: ENSXETG00000014956   Transcript: ENSXETT00000032738
Sequence length 2730
Comment pep:known scaffold:JGI_4.2:GL172647.1:606797:659958:-1 gene:ENSXETG00000014956 transcript:ENSXETT00000032738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSSNDYYDQQQFYQGEEAEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGD
LQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLDREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDEEDAKKQTPKQRLLGWIQNKIPQLPIT
NFHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFT
VETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNI
NKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQN
HQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRA
TGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKIRDAGDGVYECDYYP
VLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHIL
PASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIK
DNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
KYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGK
AKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVN
VAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGV
TSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGK
PAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESH
IPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSK
AEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPG
VEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAY
EDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKE
IVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDG
THTVNYTPATDGPYTVSVRYADQEVPRSIHSPFKIKVLPTHDASKVRASGPGLNTAGIPA
SLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKY
GGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKG
KVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVACD
TIPIIEEPCDTVQLHQPYPAHLPGYPTNWATEEPVVPVENLDTMLRPFNLVIPFTVQKGE
ITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAI
NSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVS
YMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLL
TYGLSLREGSTFSLYLYRETNHHSFSTGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVG
PSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDG
TCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRMKESITRRRQAPSIASIGSTC
DLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVG
GDPFHNVFGEFLGRESLGTFGSITRQEGEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYS
VRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEF
SIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDS
PFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECY
VSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGL
EGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISI
KYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDA
SKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVT
YTVKDKGDYILIVKWGDQNVPGSPFQVAVP
Download sequence
Identical sequences F7DCI4
ENSXETP00000032738 ENSXETP00000032738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]