SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000033273 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000033273
Domain Number 1 Region: 35-499
Classification Level Classification E-value
Superfamily Sema domain 1.24e-153
Family Sema domain 0.00000000431
Further Details:      
 
Domain Number 2 Region: 502-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000115
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 564-642
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000523
Family I set domains 0.031
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000033273
Domain Number - Region: 757-767
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000033273   Gene: ENSXETG00000015209   Transcript: ENSXETT00000033273
Sequence length 831
Comment pep:known scaffold:JGI_4.2:GL173037.1:188461:332041:-1 gene:ENSXETG00000015209 transcript:ENSXETT00000033273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRHLTSCLVVLCTVSVIGYYSTDGSPMGLDATPRITVTYNEILDLRRFSSRVSNYSTLL
LEDERGILYVGARGAIFSLNSTNISQRYQKAIPWEVTAQKHDECIKKGKNNQTECFNHIR
LLLRFNETHLYVCGTYAFSPLCSFIDSRTFVLSSETEEGKEKCPYDPAKGYVGLLVDGGL
YTASLYEFRNLPDIRRNLLQRSLKTEESNLHWLNVDPEFVSAALVQESMNVEVGDDDKIY
YFFNEKVVEENSAFLGSKTASVARVCKDDMGGKKILQKKWTSFLKARLVCYMPFYEVLKS
AYTLELGSWDTTIFYGAFILQWKNMEESAICRYSISDIQKVFEGPYMEYQYSSRKWSRYE
GEVPSPRPGSCITNEFRMNGFNTSQDLPNNVLDFVKLHPLMYEKVRPVGEQPLLVKKNII
YTRIAVDRVKALNDEYYDVLFLGTDDGWIHKAVVIGSMVHIIEEIQVYKFPQPVENLVIS
KKQNALYIGAQSGVLQIPLFGCSQYTSCYDCILARNPYCAWDGHACRDIIGAKNRTQMTQ
DMQNGNGGCLNSTDDGALKKRVRRVLKGNDVLLQCELRSNLARPQWYVNGTDKLYDSEGH
TRLGVDGLLITDTLPEHSGEYSCYSEENGLQSLVAVYSLNVLLELPKEKNYSTPTPIIQL
PTAAPQSTGNIQFIYISTITILGVLCVVLSIVLLYVSCQQKKKGKYAVRNSRSTNVELQT
VSSQFKEKAEDLNSYSDGCLQIIPGEAPTLSPHKDMPPPPPPPPPLPSEFTNGISTLPNM
LRKMNGNSYMLLRQNEESSLPSYNSFTEELSKILEKRKHTQLVEKLDESSV
Download sequence
Identical sequences F6ZZQ7
ENSXETP00000033273 ENSXETP00000033273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]