SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000033927 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000033927
Domain Number 1 Region: 83-272,303-408,506-603
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-61
Family LacY-like proton/sugar symporter 0.083
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000033927
Domain Number - Region: 433-456
Classification Level Classification E-value
Superfamily Plexin repeat 0.0392
Family Plexin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000033927   Gene: ENSXETG00000015550   Transcript: ENSXETT00000033927
Sequence length 645
Comment pep:known scaffold:JGI_4.2:GL172656.1:4578787:4638236:-1 gene:ENSXETG00000015550 transcript:ENSXETT00000033927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKASDNVEYTLRSLSNLMGEKKRRKQQQEEAAAAAGERSLIASAESCTSINSQSTGAG
DLERAARKQFQQDVTPAFVYVVSVFSALGGFLFGYDTGVVSGAMLLLKREMNLSALWQEL
LVSSTVGAAALSALAGGVLNGVLGRRPCILMASLLFTAGAVILAAARDKETLLGGRVVVG
LGIGIASMTVPVYIAEAAPPHLRGRLVTINTLFITGGQFSAAVVDGAFSYLARDGWRYML
GLSAVPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRGNQTIDEEYDSIKNSIDEE
EKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRL
AIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPV
TFTPGDPSGPNSTCTQYSYCNKCMLDPNCGFCYKKNGSSIVDSSCIPVNTDSTDRAAWGR
CMNETKSKAGGSIWAYNYCPTSYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARS
TGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLACVGLIFIYGCLPETKGKKL
EEESLFESRLCTCGASDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Download sequence
Identical sequences F6TZZ1
ENSXETP00000033927 ENSXETP00000033927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]