SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000034450 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000034450
Domain Number 1 Region: 10-246
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.42e-54
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 3149-3300
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-31
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 3 Region: 267-387
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-31
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 2825-2980
Classification Level Classification E-value
Superfamily Spectrin repeat 3.29e-30
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 1241-1392
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-29
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 6 Region: 2512-2668
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-28
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 7 Region: 573-708
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-27
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 8 Region: 2085-2238
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-26
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 9 Region: 2618-2766
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-26
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 10 Region: 1462-1604
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-25
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 11 Region: 3038-3193
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 12 Region: 1556-1705
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-24
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 13 Region: 3259-3403
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-23
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 14 Region: 834-966
Classification Level Classification E-value
Superfamily Spectrin repeat 4.23e-22
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1138-1287
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-22
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 16 Region: 1028-1183
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-21
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 17 Region: 2300-2450
Classification Level Classification E-value
Superfamily Spectrin repeat 3.16e-21
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 18 Region: 1871-2027
Classification Level Classification E-value
Superfamily Spectrin repeat 2.56e-18
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 19 Region: 3538-3628
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 20 Region: 715-776,829-867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000615
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 21 Region: 495-611
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000733
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 22 Region: 387-497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000981
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 23 Region: 1791-1884
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 24 Region: 1708-1823
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000236
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 25 Region: 3409-3471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000245
Family Spectrin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000034450
Domain Number - Region: 2034-2086
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000034450   Gene: ENSXETG00000015800   Transcript: ENSXETT00000034450
Sequence length 3633
Comment pep:known scaffold:JGI_4.2:GL172704.1:720385:838618:-1 gene:ENSXETG00000015800 transcript:ENSXETT00000034450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKVKMDEELQDYEQGHIKKLQEQRMVMQKKTFTNWMNNIYRENDCNIITDIYTELQDGLY
LLLLLELISGEQLPRPARGKMRVHFLENNSKALTFLKSKVPVKLIGPENIVDGDRTLILG
LLWIIILRFQISNITLDKVALGAWAIPLETLTATAWPRKTKSEDELLRTGFWTWALHIHS
CLWAFRPDLINYDSLTRTKPLYNLNNAFDVAETKLGISKLLDAEDVAVPHPDERSIMTYI
SLYYHYFSKMRQGQTVQKRMNNMMSLILEIENLKKQYEAMVSDLIQWIQQKVVQMNDRHF
PNSITGMRQLMTDFKTFRTVEKPPKYQERGLIEAHFFKIRTILHGNNLRPYFPPDGKSLI
DVEKYWAILEKAEYEREKALQAEMLRLERLELVAQMFNKKASLRGTYLHDMKQVIEQGDF
RPNNIAQVEAATKKLEAIEADVLPREQRFRTLADMAAVLEKENYHRKPEIVQKQQELSSG
WNGLIELLRKQKVLLEEKRHVLTLLRDIDSVVEELKSMQELLGSKDFGKQLPEVEDLLQK
HSLYESQIVSYGERVKQNLMRAEKIPVSKATSVDVLQTKVLNLQQLYQSLLSLSKSRRSR
LEETLKLYEFFRDCGEVEAWINEKWQVLGLASPERDISHITASIQKQKALEAEIYSRQPI
LAKVVRNGKELCQQSHTDQGEIQKRMDNLQTQWHHLQDEVKTSKFRLEVAALIKQYFADA
DEADSWLRERLPLLSNEDYGKDESSAEAMLQRHLRLEKEIAAYAMEMRRLGDQAQSVASK
APLIFTPKNILSFPQQQKKKPVIVIMTQEASRPLKRSYAPQINIQTEDPKHDPHMGQEEI
LASQTKLESSYENLQALAKKRRKALEEMVRLYQFYSSCGDFQSWIDDKEKLFQTFQPNPE
NLEVMQQKYENLLTDLAAGKARHDEINDLAEDLIKIAPNRKKEIQAHQKDIDNSWNHLEI
LKEQKGADLIGLADVKSLLQNCQNTEALIQEKFKELEGSEPVNATGNLDTEERKLKNLER
DIQILERKIEYLKNVEQSIRDTNPQESEAIRKQVAEMENQLEKLKQQAEEKRMSLKKAKD
QKIFLQDSRRQLLWVQDMKDKLTNEEMGSDVASAEQLLRDHQYLLIEIQREKDRIIELQQ
MGQAALQYESSSTPEVRDALITLSKEYNALGDLWVERNKRLQQGLELQQFNKEADSINAA
LSSHEAFLRVNDLGDQLDTVQSLLHRHDQFEKLLATLKKRVDSFAVNGETLVQNQHFASD
LIKQRVSDTKDRLKNVNHKSEERKKSLIDSLRLQEFNRDATELLVWMEEKYKIALDESYR
DPTNILRKLKWHEAAEKEMEANRVCYEGLLKVGHQLVGEDHYAKESIKSKMLEVTRRWED
LNNKMSERGNKLRQAGQQEQLMELLQDAKVKIEKIEKVLQAPESSHDLRSSRDLLKAHRQ
LENESQELADKMNSIVSHAQKMASNHFNSQGIMDETMKYLRRFESLQEPLAKRREFLQAK
VNQYEFYHYYDLEMKWISEKMPSASSTNYGKSLDAAQSSFQKHKELQAEVNAHIQQLQRV
LDMGKLLITSNHPESRNIAEKNKELQHSWSELERACEERMKNLQKSVSFQQFLLDVSDME
NWIVEKLPLVNSKDFGKEEDATLKLIKKHKDLQQEIELYGNLASDLERTGQSLSLPSSVR
YDEVDAPVGKINVQMRDLKERASVRWGKLEESLALYEYLRESADLQDWINQQRQLASSED
CGNDYEQVLGLFTSFLFFRMKINMLLYAQVQNITLIAKCMIQDGHLCSITRQENIIASWE
ELQQLTRERGKHLQDAEAVHKSFWDLKEALAQIKEKSKSVPDDIAKDLSGVQSQLRKQEA
LEHELSGNEHQLQEVIDAADEALPRCTTNQRVPLQQKQQEVVEKWELLKTKVEKRRTDLE
QACKLYFFLTMVRDYFSWVAGISREMMAEETIRGVLASTENLKGHQDLKQQIDAHQETYN
RAVTLGQSLLQERKAPAAQINEKLQALVEENKKLYKQWEQKRKLLEQVHQEQVFYRDVDH
LEKILNSQEVSLKSSDLGTSSGEIEQLIKKHEAFEKLFASQEEKDQANKLQDSSKWPERE
QIQQKLRSVLERRRKVKDLSRARKDELNTALLLALFYQNLTEAQYWINERMQKLDDNTHQ
QGPMDLQSKLKVLQKHQVFEAEILAHEKNIQDVTEKGNSLLSQHHPKSTEIRQKSRALHE
EWEKLKRAVAARGKMLEDNRDFLEFLQKVDQVEAWIREKEVMINVGDVGEDYEHCQQLMR
KLNEFRGAGSSDMTVDDAHIKDINALATRLERQNKEEVKTISMRRQQLNNKWNSFHGDLN
KYRKALEGALEVHSLIREIDDVNERISEKSVLMQSLDYGKDVESVENLIRRHEETERDIK
VIQAQKEHLHQEANRLSKKNQSMSECLTSKQKEMADNWQKLQVQTQERYKEGELDASYHL
QRFNTDIRELLNWTHKLQAVNEGSGLPKHLNEVEARFNEHQERKAEIEAREERYHSIKSS
GEKLCRSRHYASEEIQLSLSRAEEAWNALLKSWRDNNLKLRQARDLQIFFSLVDQNESWL
NSKEAFLANDDLGDSVASVENLQRKHEIFEKALHAQMDKIDDMETFARELQQNQHYDSEN
IANKCQAVLERKKKLLLAAESHKRKLEESRQLQKFLRNSYEVGAWMLEKNTIALDNSWRD
PSNLQAKLQKHQTFEAEIKANRNRLDDIKSDGEKMLKDHHYASDIIHTRLQEMEELWEEL
LEKCTEKAANLQEAYKALQFQRSLEDSEKWLDQVEAKLEAANKGKDLMTLEKLGEMEEDI
TSHGERLQVLVNKAREFKQEGHFLADTIDDRIRIIIHRYKSLDEPLQECRATLEAKKLLD
QFFRDVDDELAWIKEKMPLASSKECGQSLTTAQALLEKHQNLENEISSREALTKAVMGTG
RKLVKGNHFASHEIEDRLQQLEVAAETLKAEADRRRKRLNQACEAQQFLTELLEAEAWLA
ERGFVIKSTDNGKNEESTQALLRKLDTTRRDLDGFAHRINKLIDTGKGLQNDSDNPESSI
VMPKLKSVLDEYSLLLEKAEDRRSQLIEQHQLFQFKKEADLVETWLASKKATAKSDDLGQ
DLEGVKVLEKEFEDFVKEIENLGKNKVVNIIALASSLLKTPHSQEHGIKKRTEEVKTAWD
DLCSAIQHRAKVLATAHQVHEFDHEVDELMSWIQEKGVAVNSDDYGYDLPGVQALLSQHE
VFEGDLAAIKKEVERIMNRGQFISQLHPPVQKNVAERLHDVSQSWGALYRKSQDRKEKLS
QAEQAQMYFDDCGELMVWAKEMQALVVSEELANDVSGAELMIKRHIEYKREIDKHWIKYE
ELQRTGEALVQNKHFMSLEIAEKVNEMSELMNKLSESWQKRKEINEENLEIQIMRRELEQ
ADGWLNTREPYLLDQNYGDSISIVEQLLKKQEDFEKMLAAQEEKFALLRRKTKTEQNLSL
NLKAKNTELLKTDMSNNQEQQPAAVNQGSSQLSSLEVLQIASYDRTINGFMETRCKILPG
GKENVAGFWNSYYVTLRGERLSFYNAKRDEAKNETAIPSVNVRGAHCERVEDSADKANIF
IVRASDGSEYHFSAPSHRKMEVWIQAIEGKAGE
Download sequence
Identical sequences F6ZN81
ENSXETP00000034450 ENSXETP00000034450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]