SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035000 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035000
Domain Number 1 Region: 524-777
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-86
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 307-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000034
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 197-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000055
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 
Domain Number 4 Region: 47-163
Classification Level Classification E-value
Superfamily SEA domain 0.00000000745
Family SEA domain 0.0063
Further Details:      
 
Domain Number 5 Region: 496-535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 454-486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 420-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000458
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035000   Gene: ENSXETG00000016040   Transcript: ENSXETT00000035000
Sequence length 778
Comment pep:known scaffold:JGI_4.2:GL172724.1:1470189:1495484:1 gene:ENSXETG00000016040 transcript:ENSXETT00000035000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEKPKWTSRDWLRFAPLWMVLVLIAGAGITWYILEVDTSPVLRISKLYSCSLNIVSHEL
TYDLTRPESSSFRTEAAHLQKLVNGLVLASELAAYHNSCTVYAFGEGSLKIYFWVSLEVP
NTDLKYVTESSVTAALNSVLHKKTNSKGHYIFDQYHVDPNSLNILEASVHDIQLLSSSAG
CYRYSYVRAGQEIRLKGPDYLSPSCVWHLQGPPAYLIRLRLKWTRSECRDRLAMYDAAAP
LETHLITSHYGCSRQEPISEILSSGSTMLVVWKQAMYSYYDPFVLTVLPLPVESCEHSIQ
MTEGLEIQGHLRTPYYPRYYPPKPQCTWNITVPSPEYGVVLWFEGYMLTRRYTYAPCMQG
QWQIQNRSQRMCGVRVLQSYAERIDPVSGNVTVSFTCPTSLTGPGVQASYSLYNQSDPCP
GEFLCAVNGLCVPLCDGVKDCPNELDERNCVCPAQYHCPGAESCISITSVCDGKKDCVNG
TDEELCNQGANFPTAACGAFNYKCADGSCVQKPNAECDSIADCPDGSDENNCGCGIQAVG
IRLVGGTQAQEGEWPWQASLQVRGEHICGGTLVADQWILTAAHCFTPESYASPEVWTVYL
GKVRLSRSTQKELAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICLPSST
HHFPTGSSCWVTGWGSVKENGPTSDVLQKVDIQLVAQDICTELYRYQISPRMLCAGYRDG
SKDACQGDSGSPLVCKTASGRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQWIESITL
Download sequence
Identical sequences F6X0X4
ENSXETP00000035000 ENSXETP00000035000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]