SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035233 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035233
Domain Number 1 Region: 745-857
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-36
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035233   Gene: ENSXETG00000016155   Transcript: ENSXETT00000035233
Sequence length 868
Comment pep:known scaffold:JGI_4.2:GL172727.1:1262451:1332904:-1 gene:ENSXETG00000016155 transcript:ENSXETT00000035233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIRQSSERDNGKLVCKSQDAVGNLVPSLAQEREDLEERQKIRAQIHELRSAQNGGSHIA
GSKEIESNMLLRLKVPTKEQLPSSTSSSSSTSSFTSFSSEPSSSSHCQATELLSLSAEFE
GQPHNNRNEVFMEPSAEDSGTETREQPNTHVASHKQNVKSEQKPLPVWTGRADSHIISRL
GADNKESFPEGVTSASCSEPDDQTSMPPFRRAYSVRDRVKKFSEETSSVTTPALGFRFGS
MRAERAPVRGAHVLQQHSLLSVGQENNQKAAQNARFVTKQEVTRTVSGPCTRRLDGIPTA
GTQSTNKIQSFKSPFIPELNNSRSTSLKGSSSLSSTGPCTSSREVNRGLPQSQGSFILKQ
NSGRSQENQLKVPLPMTERGRIDENSDGANTEGPGSLQSSTHLCKSTKGTREETEDTDMK
TLLTIEIKDGRNQTTSSRVVGQPGNQRAELMLGLTSSPFRINSGFSTSNDGASSGITTRS
IRTETRTTTQSGITSSSNVIKVEAETPQETPQQLEVFLPSTTEKAEPENKGKLTAEDLNA
IEEEEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQREKEREQRLQELKNKERESKLAR
STETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTK
SSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMKAQSLPKTPATQARKAMI
EKMEKESGGSSSPAFAKVATPRSAAFGVPNANSIKQMLLDWCKAKTRGYEHVNIQNFSSS
WSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMRE
PDWKCVYTYIQEFYRCLVQKGMVKTKKS
Download sequence
Identical sequences F6VGP9
8364.ENSXETP00000035233 ENSXETP00000035233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]