SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000035417 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000035417
Domain Number 1 Region: 419-646
Classification Level Classification E-value
Superfamily GFP-like 2.93e-84
Family Domain G2 of nidogen-1 0.0000000167
Further Details:      
 
Domain Number 2 Region: 926-1162
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-47
Family YWTD domain 0.0000000053
Further Details:      
 
Domain Number 3 Region: 796-901
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.62e-24
Family Thyroglobulin type-1 domain 0.00054
Further Details:      
 
Domain Number 4 Region: 372-416,657-739
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 744-826,1183-1227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000173
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000035417   Gene: ENSXETG00000016220   Transcript: ENSXETT00000035417
Sequence length 1230
Comment pep:known scaffold:JGI_4.2:GL172809.1:919352:964719:-1 gene:ENSXETG00000016220 transcript:ENSXETT00000035417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYFKPRSLFFGGLLHVLFCLLPNPGNFIKVSQFFPYGPDVGDLLLTPGDDSQSEPLRPN
PALHFYDETISTLFVTTNGMIAASNPPPESDYLEQFPPDFGLIAPFLSDIDTTQGGNVFY
REDTSQDVLHLASKHIIRGFPGSSFKPTTALVVTWEDVLPYYSQRGDTIPKNKGNTFQAV
LASDESKSYAIFLYPEDGLNFYETQSKNDRNEENSARVGFSKGSERGFFWTTTQGPHNEF
ASDYDSLEILCWKTNSGMQGVWIYEIGAPNLRSVVAADVQLSATLDEKEQEENHFEETED
FTDHYVTEPDYENNSLKPSIPGPTSISVDPYQGQKDVILGNVNFQVPSFPQNNPQVVIVD
DELEDTGVVFQYNTGSQQTCANNRHQCSSQAFCKDFSTGFCCSCIPGYYGNGRQCVAEGS
PQRVNGKVKGKIYVGSNPVPVVFEGIDLHSYVVVNDGRAYTAISTIADSLGYSLLPLASI
GGIIGWMFSVQQPGYKNGFSITGGEFTRRAEVTFLQSNKKLVILQKFSGIDEHGHLTIST
ELEGSVPEIPYGSTVHIEPYTELYQTSSSVITSTSTREYTVEFPQDGSETFTYQWKQTIT
FKECVHDTTAPTVPAIQQLSVDRVFVLYNRDEKILRYASSNSIGPITDSPVDTNRNPCYV
GTHVCDTNAVCRPAQGNQYTCECTSGFRGDGRTCYDIDECQEQQDICGDNAICNNQPGTF
RCECNDGYQFLEDGRTCAAVDRPTNHCLTGTHNCDIADRARCIYTGGSSYICACLSGYSG
DGRACEDVDECETSQCHPDAVCYNTPGSFSCHCNPGYRGNGFQCFPGEPEKTACQLHLDS
ILGSPSVRGARPVGQYIPQCDESGNYIPRQCHSGSGYCWCVDRFGNELPGTRTGPGLSPP
CLGIVTHPPPTVGPPVRPDVVPLPPGTHLLFAQSGKIEHIPLEGNNMKKTDAKTLLHIPD
KVIIGVAFDCVDKTVYWTDITGPSISRASINGGEPTAIIKTELGSPEGIAVDHLGRNIFW
TDSLLNTIEVAKMDGSNRRVLFDTDLENPRGIVADAPKGNLYWTDWNRAAPKIETSYMDG
TNRRILVKDDLGLPNGLTIDPYSSMLCWIDAGTKRMECMNPSQPARRKIVEGIQYPFGIT
SYGKNLFYTDWKRDAIVAIDRTISKESDSYQPPKRSRLYGITTAYSQCPQGQNYCAVNNG
GCTHLCLATPGGRSCLCPENSIGVDCLDRN
Download sequence
Identical sequences F6VE55
ENSXETP00000035417 8364.ENSXETP00000035417 ENSXETP00000035417 XP_002935874.2.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]