SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036203 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000036203
Domain Number - Region: 301-346
Classification Level Classification E-value
Superfamily Plexin repeat 0.000279
Family Plexin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036203   Gene: ENSXETG00000016596   Transcript: ENSXETT00000036203
Sequence length 503
Comment pep:known scaffold:JGI_4.2:GL172683.1:3334706:3459839:-1 gene:ENSXETG00000016596 transcript:ENSXETT00000036203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSCHVVGEHFQFNPDHCHSCIADVSYSVNTVKPRVDEIVSVDTHMYSHRWKRQSVDTNR
PSVGQDFPDMFLEGTNENGTEIEEDTDHKYYTSRTYGPLDPASRDLWVNIDQMEKEKVKI
HGILSNTHRQAARVNLSFDFPFYGHFLREITVATGGFIYTGEVVHRMLTATQYIAPLMAN
FDPSVSRNSTVRYFDNGTALVVQWDHVHLRDNYSLGSFTFQATLINDGRIVFGYKDIPVP
VMQISSTNHPVKVGLSDAFVVVHKIQQIPNVRRRTIFEYHRVELEMTKITNFSAVEMLPL
PTCLQFNSCSSCVSSMIGFNCSWCNILQRCSSGFDRHRQDWVENGCAEESKDTVCEDLLQ
TTGVSHHATTGLHATTSIYSFTTTARMASHFPSSLPTEDDTKIALHLKDNGASTDNSAAE
MKNGTLHTGLIIGILIVILLVITAILVAVYMYHHPTSSASLFLIERRPSRWPAMKFRRGS
GHPAYAEVEPTGEKEGFIVSEQC
Download sequence
Identical sequences F6WLW2
ENSXETP00000036203 ENSXETP00000036203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]