SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036514 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036514
Domain Number 1 Region: 377-499
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.14e-20
Family Mannose 6-phosphate receptor domain 0.0071
Further Details:      
 
Domain Number 2 Region: 210-257
Classification Level Classification E-value
Superfamily EF-hand 0.0000151
Family Calmodulin-like 0.059
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000036514
Domain Number - Region: 38-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000732
Family LDL receptor-like module 0.0046
Further Details:      
 
Domain Number - Region: 88-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0288
Family LDL receptor-like module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036514   Gene: ENSXETG00000016744   Transcript: ENSXETT00000036514
Sequence length 512
Comment pep:known scaffold:JGI_4.2:GL173084.1:161138:170742:1 gene:ENSXETG00000016744 transcript:ENSXETT00000036514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLLLLLVGVLGCWAVEVKRPRGVSLSNRAFYDDSKPFTCLDGSRTIPFDRVNDDYCD
CADGTDEPGERGILCLQIHNGEGSWSPSYIPSSRINDGICDCCDTTDEYNSGALCENTCR
EMGKKEREELQMAAEIAREGFRVKQLLIEDARKGREEKQTKLQDMVQRRQALQSQVDALR
LQKEEAEKPEQEAKDAHQKAWEEHKEAEKAEEDKQRSLEVFTELDQDSDGMLAASELRSH
MELDVDGDGAMSDEEAQSLLGDTSVDVGIFQESVWPQIREKFKSETDAQAVPPIEEPTES
HPEVPEDEDEEDGDEGEDDEEDEPEEDIRVPPSKAQEAEPEMPPYDEVTQALIDAAQTAR
STYEEAEKSLRDMEDTIKGLEKEISLDFGPTGEFSYLYGECYELSTSEYVYRLCPFNRVT
QKPKHGGSETNLGSWGSWAGPEDNKFSFMKFEHGTSCWQGPNRSTLVKLSCGKDSILTST
SEPSRCEYLMEFFTPAACHPPPEVLPDDHDEL
Download sequence
Identical sequences F6TFY9
8364.ENSXETP00000036514 ENSXETP00000036514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]