SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036749 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036749
Domain Number 1 Region: 49-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-32
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 170-292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-19
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 3 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036749   Gene: ENSXETG00000016864   Transcript: ENSXETT00000036749
Sequence length 529
Comment pep:known scaffold:JGI_4.2:GL173260.1:389057:451927:-1 gene:ENSXETG00000016864 transcript:ENSXETT00000036749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHGRSLFHIVTSLIILHVSWATKTGEDKQTTTEGQKPVECGSWTKHSNGGTFTSPNYPN
KYPPDRECIYIIEAAPRQCIELHFDENYSIESSWECKFDHIEVRDGPFGFSPIIGRYCGQ
QSPPFIKSSGRFLWIKFFADGELQSLGFSAQYNFTPDPDFKDLGILKPLPVCEFEMGGPE
GIIESMQIVKEGKASANEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLRAKFCSTVANDVMLSTGLGVIRMWADEGSRTSRFQMLFTSFQEPPCEANSFFCH
SNMCINNTLVCNGIQNCVYPWDENHCKEKRKSNLLDQLTNTSGTVIGVSSCIVIILIIIS
VIVQIKQPRKKFVQRKTDFDQTVFQEVFEPPHYELCTLRGTEPTADLADVADDFENYHKL
RRSSSKCIHDHHCGSQISSIKGSRSNLSMRDASLLSETQSQPVKPLNRRNILVMKHSYSQ
DAADTCDIDEIEDVPTTSHRLSRHEKAVQRFCLIGSLSKHETEYNTTRV
Download sequence
Identical sequences F6U6M3
ENSXETP00000036749 gi|301622397|gb|XP_002940520| XP_002940520.1.99540 XP_004915318.1.99540 ENSXETP00000036749 8364.ENSXETP00000036749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]