SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000038015 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000038015
Domain Number 1 Region: 233-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-49
Family DBL homology domain (DH-domain) 0.000000133
Further Details:      
 
Domain Number 2 Region: 425-550
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-35
Family Pleckstrin-homology domain (PH domain) 0.00000892
Further Details:      
 
Domain Number 3 Region: 1-113
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-28
Family Calponin-homology domain, CH-domain 0.00074
Further Details:      
 
Domain Number 4 Region: 165-230
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.0000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000038015   Gene: ENSXETG00000017497   Transcript: ENSXETT00000038015
Sequence length 770
Comment pep:known scaffold:JGI_4.2:GL172667.1:1834301:1902879:-1 gene:ENSXETG00000017497 transcript:ENSXETT00000038015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEEQTVTWLISLGVLSSPKKNICNPADFLKCSLKDGVVLCKLMNRLLPGFVSKVCTEP
KSEEDCIENIKEFLKACSALRVELFDPVDLYTGENFSKVLSTLSAVNRATENPTSGRPCS
GRLSQSHSIPACSQINSQGTYCSTRVLKRQSKALDMTGNGSCQLVVKARFNFNQQNEDEL
SFCKGDTIYVSRVEDGGWWEGTLNGKSGWFPSNYVKEFKSNDKPLSPKAVKACETAQLTK
NYYTVVLQNILETERSYAKELQLLLSTYLRPLQSHDKISAVDVSSLLGNFEEICTFQQTL
CQALEECAKLPENHQKVGGCLLNLFNQFMSLYLSYCSNHPMAVHVLTQQSDELGTFMENQ
GAPVPGILMLTTSLSKPFIRLEKYVTLLQELERHMEEAHPDHKDILKATAAFKTLVTQCQ
DLRKRKQLELQILSESIQGWEGEDIKTLGTAVFMSQVMVQCGTNEEKEERYFMLFPNALL
MLSASPRMSGFIYQGKLPLTGMSVVKLEENDTTNHGFEIAGTMIERIVVYCNNSHDCQEW
LEHLHRLTKGTGSHASLCKTQSLTSTSYSCFHSSVTPRGPLEPAKLYKAWTLSCLRPAPP
LRPSYALGYKERMSYIFKDSSKSPKNVKKFLPKRKTERKPSDEDSGFRKSTVALEEDAQI
LKVIEAYCTGAGFQQSLCSGSRKDSVAQVLLLEEENLIIDELRTNGQTVSEEKSLVDTVY
ALRDEVMELKQENKRMKQCLDEEQKSRKELEKIVWKILKQANDSTRDDPS
Download sequence
Identical sequences F7BWF4
ENSXETP00000038015 ENSXETP00000038015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]