SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000038816 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000038816
Domain Number 1 Region: 3929-4133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-38
Family Laminin G-like module 0.0005
Further Details:      
 
Domain Number 2 Region: 1541-1557,3518-3690
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.29e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 322-408
Classification Level Classification E-value
Superfamily Immunoglobulin 6.63e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 1861-1949
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 3347-3432
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-18
Family I set domains 0.0075
Further Details:      
 
Domain Number 6 Region: 3424-3512
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-18
Family I set domains 0.009
Further Details:      
 
Domain Number 7 Region: 2778-2862
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 3763-3868
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.59e-18
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 9 Region: 1578-1671
Classification Level Classification E-value
Superfamily Immunoglobulin 4.32e-18
Family I set domains 0.042
Further Details:      
 
Domain Number 10 Region: 2971-3058
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 2284-2368
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 12 Region: 3066-3157
Classification Level Classification E-value
Superfamily Immunoglobulin 8.43e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 13 Region: 1670-1757
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-16
Family I set domains 0.0000463
Further Details:      
 
Domain Number 14 Region: 2679-2770
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 15 Region: 2574-2664
Classification Level Classification E-value
Superfamily Immunoglobulin 7.02e-16
Family I set domains 0.036
Further Details:      
 
Domain Number 16 Region: 3152-3240
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-16
Family I set domains 0.034
Further Details:      
 
Domain Number 17 Region: 2387-2473
Classification Level Classification E-value
Superfamily Immunoglobulin 8.48e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 2878-2958
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000104
Family I set domains 0.014
Further Details:      
 
Domain Number 19 Region: 1770-1856
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000113
Family I set domains 0.019
Further Details:      
 
Domain Number 20 Region: 1960-2045
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000425
Family I set domains 0.019
Further Details:      
 
Domain Number 21 Region: 2190-2273
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000188
Family I set domains 0.027
Further Details:      
 
Domain Number 22 Region: 3264-3341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000199
Family I set domains 0.019
Further Details:      
 
Domain Number 23 Region: 2476-2562
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000478
Family I set domains 0.038
Further Details:      
 
Domain Number 24 Region: 2055-2178
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000129
Family I set domains 0.04
Further Details:      
 
Domain Number 25 Region: 240-277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 26 Region: 682-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 27 Region: 199-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 28 Region: 1463-1515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 29 Region: 114-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 30 Region: 284-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 31 Region: 745-859,1044-1059
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000033
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 32 Region: 1522-1570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 33 Region: 3872-3915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000038816
Domain Number - Region: 1123-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000121
Family Laminin-type module 0.044
Further Details:      
 
Domain Number - Region: 1184-1227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00276
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 1427-1465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00479
Family Integrin beta EGF-like domains 0.075
Further Details:      
 
Domain Number - Region: 647-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0452
Family Laminin-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000038816   Gene: ENSXETG00000017911   Transcript: ENSXETT00000038816
Sequence length 4157
Comment pep:known scaffold:JGI_4.2:GL173685.1:35626:98279:1 gene:ENSXETG00000017911 transcript:ENSXETT00000038816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYYRALVNFTQSIEYSPELDNVSSPEFIDLSEAVVDTLESEYHKIPGEQMVSVVYVKVID
GDTFVELDVGSEGYSNDAEIRQVLFSVIDSRSIASYITSAQGFQFRRLGSVTPSLRPCRD
DEFTCTSGDCVPAEYRCDHRHDCRDMSDELECATPGPNLGPVSTARPATTPPRPFTRPPV
IATTPYKPFTHKPPPDLETRQCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPS
PCEPNEFKCKNGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIP
ASYQCDDEADCPDRSDEVGCNPPQVITPPEESIMASRGDTVRFTCVAIGVPTPIITWRLN
WGHIPTSSRVSMTSENGHGTLIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILKPHRG
PCPEGSFYVENSARCIPCFCFGVTKVCQQTGRYRNQIRLRFDVPEDFKGVNFTVPSHVGI
PPLSSNQLQIDTSVEEFQLVDLSRRFLSIDSFWTLPGQFLGNKVDSYGGSLSFKVRYGLT
RGQSEPVRKPDVILVGNGRKLIYRVQTSTQPSIVNQRKIQFTEENWQHESGASVTREDLL
MTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAVGVEECRRCPGGYAGPSC
EVCAAQFERVPGGPFLGTCSGCNCNGHASSCDPVSGYCLNCQHNTEGPQCNKCKAGFFGD
PTRGVSDACRPCPCPHTDPRRRFSDTCFMDVDGQPTCDSCAPGYTGRRCERCAEGYDGRP
MQPGGRCEPVGNVCDVKGALSTGDGSCVCKSHVEGNFCNECKSGTFYLSEKNPDGCLKCF
CMGITRQCSSSFWNRDQQQVSSTYDSQDRVPFTISNAGSTRTLSESIRVTGQSELTFSNF
LNVPQDVYFWVLPDRFKGDKVTSYGGELRYTITFEAPAGSQPLFGQPDVVLQGNGIFLEH
SANTRTAPGFPITITVPFRERAWRRADGQDATREHLLMALADIDLLMIRASYAERMVETR
ISNIHMDVAVPYPTDRQRAVEVEHCVCPPGYSGPSCQVCAPLALLFFASKTGLRAIAFCS
INRGAVGDPGQARPPHPTPPGKFILYQSWHGVITVGLPTALGQYFGTCFLDRDGHPTCDS
CPVGYAGRQCERCAPGYRGDPARGQPCTADGGSSCPCDLRGSVSDRCDSRRQCECKPNVE
GASCGTCRPHHFYLSTENPDGCLPCFCMGVTQQCTSSTYHRELISTPFLPGNFQNFALVN
RQRSSRITSGFTVEMSRHGPQLTHSSFDQLGQESYYWQLPEGYQGDKVASYGGKLRYTLT
YNAGIRGSALPDADVQITGNDITLVAYQHDLRPRESKSFEIVFRESSWKRPDGQPATREH
LMMALADLDEILVRASYSTDMLSSSITGVSMETAGPSYTNLPQALEVEECRCPPGYQGLS
CQDCAPGYTRTGGGLYLGHCEPCYCNGHSESCHPETGACSNCLHNTVGESCDQCAPGFYG
DASAGTPEDCQPCACPLTNPDNQFSKTCEILGTSGYRCTACQPGYTGQYCERCAPGYTGN
PNIPGQKCVPEDSRSKLIVRIHPQKATLSPGGEVTLRCHVSGNPPYYFYWTREDGRPIPP
SAKAVGEGENLHFSRVQPTDSGVYICTCRSPESVNTSKAEIVVSAAPSKPITVTVEEQRV
QTVRPGSDVTFICTAKSKSPAYTLVWTRQHNRKLPDRAMDFNGILTIRRVQPEDAGIYVC
TGSNMYDMDEGNATLYVQGAGTATSPNAAAEPRQLTVQRGQTAEFRCTATGTPTPAVEWT
ELLSLAGPNGGLSPRAVVQGGVLRFHSVEPSDEGQYTCRVHNSAGQHFARVDLRVHSGSL
PEVQVSPERTEVREGDTVRLYCRAGGTPAATISWRKEGGSLPPQARTERTDISTLVIPSI
SAADGGTYLCVGTSSAGSAQARIEVIVIGEAPIHGPTLRIEPSSDTVIEGQLVELNCVSA
NPYATVTWHRGGGRPLSPNHQAYGSKLRILQASTADSGEYICRVTNGAATQQASIIITIT
RSSGPQQLPASGNVPALRIEPSSDTLVEGQTLELNCLFPSYPNAVVTWHRSGQPLSPNHQ
VSDGEGQVEGGACSTSFHWPVVPGFWFPITAVYWLNWQVSGPRLRILQASVADSGEYICR
VTTGPVTQKASILVTITRASGPSIPLGNGPAVRIETSSGSVVEGQTLELNCVVAGQPDAV
VTWHRAGRLLSPNHQVLGSRLRITQASVADSGEYICRTTTGTTTRQGSIMVTITHSTSSA
SLITPTINIESAPDSVAEGQTVVLNCVIEGRPHQEVTWYRPDQPLAPNHQVSGSRLRITH
ASPRDSGEYICRIQSGAGVQMASIMVSIEGSSLSEYQDTGLGSPIRIESSSETVELGQTI
ELNCLAEGHPGAVVTWHRSGGLPLPSNHQVSGSRMRILQASPADSGIYICRVSSASGSQE
ASVTINVHSSAQVPNQFPYPILIEKSADTVSEGQTLDLNCVVVGQPQAPVSWHRPGASFS
SNHQISGSRLRIVQASTADSGQYVCRHDTGAGIQQASISVSILSGAASSYRLQSPVISID
PHSATVQRGQNATFKCRIHDGAQPIRVTWQMRHNQPMEDNVHISPNGSIITIVGATHKNQ
GSYRCMASNAYGMVHSSVNLVVQGKWHQLPPVLTQPPLGNPPLVIPHGKIRVKEGEPINV
ECMGIGDPRPIVSWRRTGARENLKQHRLAPLDGTAVLQIPSAKPADSGSYTCVAHNPHGS
TQVHVEVHVEGHVISPGAPLVLADKPVHVVVTGGQATLSCSASGNPTPTITWSKLRAPLP
WQHQVVNNTLIIPNVAQQDSGQYICNASNADGHAEVYVTLDVESTCSAGTGFNPTAPAYA
TTLPHEASVSPGEPIQIQCLAHGTPPIKFQWSRVDGTLPGQASIQDGVLHIDQASASDSG
TYRCVASNKVGSSEAFAQMSLVLPGRPTASIIPRGPVRVKVGSPIYLECMGQGDPRPVVS
WRRTGDRQNLKPQQLVPLDSHAVLQILSARPEDSGSYTCTAQNPSGSTQVQVEVHVEGRV
ITPGVPKVTAEQPLHVVVAGDRASLSCTAVGNPAPKITWSKLRAPLPWQHEIVNDTLIIP
KAALQDSGQYICNASNAEGYSEVFVTLDVETPPYATTLPDEVSVSVGEVIQIQCLAHGTS
PLKFQWSKVNGSLPDRATVRDSTLHINLAKAADAGTYRCVVGNKVGSSKTFAQLIVTMVP
LTQYLSLRSAPFAVRVSPLIDTKAVSGTAEFTCTVVGDPRARIQWSKEGGQLPAGHQVQG
GVLRIPNLESGNEGTYTCRVSSRFGQAQESVRLVLQALPKVRINIRTSVQTVLAGNSVEF
ECLALGDPRAKVTWSKVGSRLPADAVISGGTLRIEQVKQSDAGQYRCTAANDVGEVQSHV
ILHVQSVPQIAAQPEMKEITAGSTAVFPCLASGFPVPDITWSKLEGDLPSDHQIDNNVLT
ILSVKPEDAGTYVCTAANRQGRVTAFSMLKVRERVVPYFTGQPQSYLSLPSIKDAHKKLE
IKITFRPDTADGMLVYSGQKKSNGADFVSFGLVGGRPEFRFDAGSGMATIRYPTAISLGE
FHTVTLYRNLTQGSLVVDRHVPVNGTSQGKFQGLDLNEELFLGGYSHYDSISKTGLNSGF
VGCVRQLIIQGEEVIFKDLDLSANGVSNCPTCRDRPCKVPLQKVASVDSRETWQQLCNMV
TVGQDGDSRARWRQYKMGRRKKKGVQVGRVTNEGVNGPLVVPTGLAILRSLEPVTLGQWH
KVSAERVNKDGTLIVDGTDPVKRSAPGKSQGLNLKTLMYLGGVDGSVELPSAANISRHFQ
GCIGEVSINGKKVDISYSFTESSAIGQCYDNSPCDRMPCLHGGRCQPTGEYEYQCLCLDG
FKGDRCETHEDQCQIHNPCLNGATCKDNRCHCPSGYSGTICEHGRTAGAEDRDWPVEGSG
GNDAPGLYGSFFSDDSYIALPKHVFPRSRPEAPETIELEIRTSSSEGVILWQGMEENEQG
KGKDFISLGLKDGHLVFSYQLGSGEANIRSEDPVNDGEWHRIVAVREGKLGSIQIDGEDS
VSGASPGRNIMVNTKGSVYLGGAPNVKTLTGGKFSSGINGCIKNLVILNARPSQQPHQPI
DLKHHAEAGHNTKECPS
Download sequence
Identical sequences F7CCA0
ENSXETP00000038816 ENSXETP00000038816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]