SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000038826 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000038826
Domain Number 1 Region: 590-845
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-87
Family Eukaryotic proteases 0.000000922
Further Details:      
 
Domain Number 2 Region: 328-434
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 202-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-24
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 4 Region: 73-185
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000209
Family SEA domain 0.0099
Further Details:      
 
Domain Number 5 Region: 435-476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 511-547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 474-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 551-590
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000038826   Gene: ENSXETG00000017920   Transcript: ENSXETT00000038826
Sequence length 846
Comment pep:known scaffold:JGI_4.2:GL173288.1:352949:390073:1 gene:ENSXETG00000017920 transcript:ENSXETT00000038826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDSDSMMKYNNRPQSMNGFEEGVEFLPAANTKKVEKAGPKKKLAIFGVVIGAALLSLTI
GLLVWHFAYRNAPVQKLYTGYLRIANTQFVEAYENSTTREFADLSVKVISTLRTLYNGEK
DIAPYLQQCSISAFSEGSDNNVVGYYWSEFSVPAFREEAFEKAISELKLPTVNLRQRAFA
VDSLVAYPTDPQIARNFKNSSCAFFLHSSAGVMTKFSSPGFPDTPYPPNARCLWTLRADA
GQMIRLKFKTFKMEKCKANAGDFVMVYDSLSPIEPRAQIRLCGIYPPSYNLTFFSSSNVM
LVTLVTDNVGKFPGFLAEFSQFPKTSLCGGYIRDASGVFTSPYFPGHYPPKIECIWDIQV
PDNKFVKLRFNMFYLAEPGVPVTKCTKDFVEINGQKYCGERKFFVVSNNSSKMSVRFVSD
QSYTDTGFTAEYLSYEPRNPCPDQFACKSGRCIRLDQKCDGWNDCEDFSDEKSCTCTALQ
FRCTNSKLCKPSYFVCDGVNDCGDSSDELACQCPNNTYKCGNGKCIPESQKCDRTDNCGD
GSDEAECGRVLTTTCTEYTYKCKNNQCITKKNPECDGENDCSDGSDEISAKCNCGKRPFT
KKSRIVGGVNADTGEFPWQVSLHVKGNKHTCGASLVSPTMLISAAHCFQDDQSMSRYSDA
SLWTAYLGLHDQAQLNSKDVVERKIKRIMAHIGFNDNTYDNDISVLELEKPVDYTDFIQP
ICIPESTHDFPVGKPIWVTGWGALKEGGGAAVILQKAEIRIINQTECNKLLDGQLTPRML
CAGFVSGGIDACQGDSGGPLSSVELNNKVYLAGIVSWGEGCARRNKPGVYTRVAMMRDWI
RDKTGL
Download sequence
Identical sequences F7CC11
ENSXETP00000038826 ENSXETP00000038826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]