SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000038879 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000038879
Domain Number 1 Region: 23-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-87
Family Calponin-homology domain, CH-domain 0.0000231
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-32
Family Spectrin repeat 0.000000401
Further Details:      
 
Domain Number 3 Region: 515-636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-29
Family Spectrin repeat 0.00000107
Further Details:      
 
Domain Number 4 Region: 400-510
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-25
Family Spectrin repeat 0.00000189
Further Details:      
 
Domain Number 5 Region: 744-871
Classification Level Classification E-value
Superfamily EF-hand 2.6e-21
Family EF-hand modules in multidomain proteins 0.029
Further Details:      
 
Domain Number 6 Region: 639-751
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-19
Family Spectrin repeat 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000038879   Gene: ENSXETG00000025296   Transcript: ENSXETT00000038879
Sequence length 899
Comment pep:known scaffold:JGI_4.2:GL172710.1:2829932:2864542:-1 gene:ENSXETG00000025296 transcript:ENSXETT00000038879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATTMTQAVTNETYNYCYDEEEYMNQEEEWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGT
MIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFH
TSWKDGLGLCALIHRHRPDLIDYSKLNKDDAVGNINLAMDVAEKYLDIPKMLDAEDIVST
AKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERMMEEYERLASELLEWI
RRTIPWLENRTSEKTMQAMLKKLEDFRDYRRKHKPPRVQEKCQLEINFNTLQTKLRISNR
PAFMPSEGKMVSDIANAWQRLEQGEKGYEEWLLTELRRLERVEHLAEKFRQKASLHESWT
AGKEQLLLQKDYETASLTEVRALLRKHEAFESELAARQDRVEQIAAIAQELNELDYYDAA
RINERCQKICDQWDRLGTLTQKRREALEEQRTEKLLETVDQLHLEFIKRAGPFNIWMEGA
MEDLQDMFIVHNVEEIQKLITAHEQFKATLPEADSERQAILGIQNEVEKVIQSYNIKISS
HNPYSSITLDEIRTKWEKVKQLVPIRDQTLQEELARQQNNERLRRQFAGQANVIGPWIQK
QMEEIGRSCIDFTGTLEDQMNSLKMLEHNIVNYKHNVDKLEGDHQMIQESLIFDNKHTNY
SMEHIRVGWELMLTTVARTINEVETQILTRDAKGITQEQINVFRSSFNHFDKKKNGLMEH
DDFRACLISMGYDLGEAEFARIMALVDPSGIGTISFQSFIDFMTRETAETDTSEQVIAAF
RILAADKPYILPEELRRELPPEQAQYCLSKMPTYTGPGAVPGALDFTCFSSALYGESDL
Download sequence
Identical sequences F7B6H7
ENSXETP00000038879 ENSXETP00000038879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]