SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000038881 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000038881
Domain Number 1 Region: 17-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.06e-85
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 265-387
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-34
Family Spectrin repeat 0.000000564
Further Details:      
 
Domain Number 3 Region: 501-622
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-32
Family Spectrin repeat 0.00000303
Further Details:      
 
Domain Number 4 Region: 388-496
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-25
Family Spectrin repeat 0.00000345
Further Details:      
 
Domain Number 5 Region: 625-737
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-22
Family Spectrin repeat 0.00000275
Further Details:      
 
Domain Number 6 Region: 737-839
Classification Level Classification E-value
Superfamily EF-hand 4.2e-19
Family Calmodulin-like 0.079
Further Details:      
 
Domain Number 7 Region: 841-911
Classification Level Classification E-value
Superfamily EF-hand 8.42e-18
Family EF-hand modules in multidomain proteins 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000038881   Gene: ENSXETG00000017933   Transcript: ENSXETT00000038881
Sequence length 912
Comment pep:known scaffold:JGI_4.2:GL172781.1:607637:669043:1 gene:ENSXETG00000017933 transcript:ENSXETT00000038881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHYDSQNNYMQQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDG
LKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKM
TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCAL
IHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYV
SSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAP
ENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVS
DINNAWGGLEQAEKGYEEWMLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQKKDY
ETASLSDIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSQTVNARCQRICDQ
WDNLGALTQQRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIE
EIQGLTTAHEQFKATLPEADKERQAILGIQNEISKIMQTYHVNMSGSNPYTSITPQEINN
KWDHVRQLVPRRDQALTEEHARQQQNERLRKQFAAQANVIGPWIQTKMQEIGRIAIEMHG
TLEDQLNNLRQYEKSIVNYKPKIDQLESDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLT
TIARTINEVENQVLTRDAKGISQEQMNEFRNSFSHFDRDHSGRLGPEEFKACLISLGYDI
GNDPQKKSGFLESDDFRACLISMGYNMGEAEFARIMSIVDPNRLGLVTFQAFIDFMSRET
ADTDTADQVMASFKILAGDKNYITADELRRELPPDQAEYCIARMAPYLGPDAVPGALDYM
SFSTALYGESDL
Download sequence
Identical sequences F7B6G0
ENSXETP00000038881 XP_012824128.1.99540 ENSXETP00000038881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]