SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000039399 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000039399
Domain Number 1 Region: 77-487
Classification Level Classification E-value
Superfamily Sema domain 1.01e-132
Family Sema domain 0.000000042
Further Details:      
 
Domain Number 2 Region: 483-536
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000144
Family Plexin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000039399   Gene: ENSXETG00000018164   Transcript: ENSXETT00000039399
Sequence length 739
Comment pep:known scaffold:JGI_4.2:GL174220.1:12112:23532:1 gene:ENSXETG00000018164 transcript:ENSXETT00000039399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTWKRCWGLLLALLALLPCLPSDLVPRITFRHGEWSVAVSRVRTSHEWGRSELISRSLF
IQKVKNGTPPIRPHYLLHFPLPDIGSAAALQNSEHWQTECFNFIRILAPVNGSHLYTCGT
YAFNPTCTYIELDHFSMPKNPNGTIITMDGRGQSPFDPQHNYTSITIDGELYTGTMNNFR
GNEPVIFRNLGTKVSLRTEGSHGWLNADAVFVGSFNPQGSSPDSKVYFFFDETTREYDFF
EKMTVARVARVCKNDVGGEKVLQKRWTTFLKAQLTCSLQNHFPFNILHHVALQNQPDPNN
SIFFGVFRTQWQLGGRRSSAVCLYKLNDIEKVFNGAFKEQNKESSKWNRYMGVVSDPRPG
SCSGGKFSDTDLNFMKEHFLMDEVVSPGAGRPVLVKQNVQYTRIALDSVQSVSGLNYTVM
FLGTDKGFLHKAVLMGNGSESHIIEEIELLTPEEPVENILLAANEGVLYIGYSAGVLRVP
LANCTVYQSCFDCILARDPYCAWDGASQRCRSVRSEQDKGKSWLQDIERGNPNTTCFSIG
TPRVMRPPSASVKGSPEENYSSCYNTILELRCPHRSALATYSWKTPDLAAPEMQMVTAED
AQVIIVREDTEGLYECWATESSYRYQVAHYWVRPVSCPGSVAPNTAERDYYKQFVVVTVL
LVLTLLGCLGLGLYSVRDKLRARSKIQGCSTPETIKLSDSKEKKPLNGLCDGDGAKPCCV
PLGRSTGKMDLENNSVAIS
Download sequence
Identical sequences F6V936
ENSXETP00000039399 ENSXETP00000039399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]