SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040369 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040369
Domain Number 1 Region: 30-497
Classification Level Classification E-value
Superfamily Sema domain 3.01e-133
Family Sema domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 1350-1476,1672-1861
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.31e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 1039-1143
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000478
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.037
Further Details:      
 
Domain Number 4 Region: 855-953
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000292
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 952-1041
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 6 Region: 500-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000759
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1159-1231
Classification Level Classification E-value
Superfamily E set domains 0.0000011
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 809-843
Classification Level Classification E-value
Superfamily Plexin repeat 0.000017
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040369   Gene: ENSXETG00000018635   Transcript: ENSXETT00000040369
Sequence length 1891
Comment pep:known scaffold:JGI_4.2:GL172984.1:653387:841367:-1 gene:ENSXETG00000018635 transcript:ENSXETT00000040369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKPLPFHLWTFLVLLGSWIAAGDGTPKSFRTFTGTDWSLTHLVVHNKTGEVYLGAINRIY
KLSNNLTLMRTHVTGPVEDNEKCYPPPSVQSCPHGLVSTNNVNKLLLIDYSENRLIACGS
ASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVPNGQNKLFVGTPIDGK
SEYFPTLSSRKLMGNEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIYYVYSFSSEQ
FVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCIKDGVEYRLIQD
AYLSKPGKRLAKELGISEREDILFTVFSQGQKNRIKPPKESVMCLFTLKKIKDKIKERIQ
SCYRGDGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVTIEGTPLFLDKEDGM
TSVAAYDYRGHTVVFAGTRSGRMKKILVDLSASSHMAQQYENVVVHEGNAILRDLVLSPD
RQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERADELHR
FTSDQRQCVQLTVHPRNISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGRILDGKI
YCTSPSTKDVIPITRGHGGQRVLKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSF
PCHWCKYRHVCTHNAADCSFQEGRVNMSEDCPQILPSTQIYIPVGVVKPITLTAKNLPQP
QSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSTWQPVTPSWTQEKTKGKAPICRMA
AWDGSPCLFPLQDSGTNRAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPA
YENPWMHASTVNSRCTDPKITKLFPETGPKQGGTLLTITGENLGLRFEDIRFGVRVGHVM
CVPIENEYISAEQIVCEIKDAGKMRVHEAQVEVCVKDCSQDYRAISPKSFTFVVPSFNRV
TPSRGPLSGGTWISIEGSYLNSGSDVSVDIGGRPCMFSWRTAKEIRCKTPQGPSTGKAEI
QIHINRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKIRAKYG
DAERENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLY
YPDPVFEPLTASGNLELKPSSPLIIKGRNLIPAAPGNFRLNYTVLIGDTPCALTVSETQL
LCESPNLTGQHKVTIKAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIA
YKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRT
YAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDR
GNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFT
FLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLN
CVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAGDMDLEWRQGRMARI
ILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYAES
MLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLA
TKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDYDVRHTWKSNCL
PLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKD
IPNYKSWVERYYADIAKMSVISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYRDE
ILTALEKDEQARRQRLRSKLEQVIDTMAQSS
Download sequence
Identical sequences K9J8B2
ENSXETP00000040369 ENSXETP00000040366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]