SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040451 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040451
Domain Number 1 Region: 123-366
Classification Level Classification E-value
Superfamily vWA-like 1.89e-69
Family Integrin A (or I) domain 0.000000995
Further Details:      
 
Domain Number 2 Region: 370-451
Classification Level Classification E-value
Superfamily Integrin domains 3.19e-20
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 617-695
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000123
Family Integrin beta tail domain 0.0043
Further Details:      
 
Domain Number 4 Region: 23-79
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000214
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 575-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Integrin beta EGF-like domains 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000040451
Domain Number - Region: 538-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040451   Gene: ENSXETG00000018634   Transcript: ENSXETT00000040451
Sequence length 768
Comment pep:known scaffold:JGI_4.2:GL172854.1:1356254:1384858:-1 gene:ENSXETG00000018634 transcript:ENSXETT00000040451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSHQPQILTNRNNLSSVTATSKVCTKFKVSNCNECIQSGPFCAWCKQPNFTSAGEPDSV
RCDTDEVLGKRGCKEVDIVYHDSRSVVKDRTRLSDRVQLTPREISLQLRPGKAAEFDVTF
RRAQGYPVDLYYLMDLSYSMNDDLQNVKNLGSNLLEALNKITTSAQIGFGSFVDKTVLPF
VNTHPEKLKNPCPERNENCQPPFAFKHILKLTEDGKQFQDQVGKQGISGNLDAPEGGLDA
MMQVAVCGDKIGWRNVTRLLVYATDDGFHIAGDGKLASILIPNDGQCHLEDNLYKRSNEF
VSVKRVWKKCNELSNLHKLPALIQVLNQKSWENLSKLIPKSVVGELSSDSRNVVQLITDA
YQALSSEVILDHGTTPDFLEILYDSLCPGDIKENQLKGMCSNVKIGEEIKFKVKVTASKC
LQDQSFAIRPLGFTDTLTVSVRTLCDCECDETPRPGDCNSNGTIKCGICRAGTRGRNGEF
RDQPRSEETNQRGSCKILNASVCYEGLIKQSHVSFVLWVSSQALFENKAEKQNMAMCMVN
SVICSSSLTPGTCDCGVCRCNEGYEGSACQCKRSTSNCKNAKGSVCSGRGKCECNNCICK
PGYLQPHCESCPGCPSPCSKFGPCVECYINQEDGSTQNCSHLCPGVKAERVEELKRETVC
KEKDSSNCWMQYVIVEDDGEDKFTITYTLKRECPEAPNFVAIVGGTTAGVILIGMACLII
WKIITEIKDRNEYNRFEKERQNCKWNQASNPLYHKATTTVQNPNFSGE
Download sequence
Identical sequences F6YP40
ENSXETP00000040451 ENSXETP00000040451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]