SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000041039 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000041039
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.54e-50
Family Calponin-homology domain, CH-domain 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000041039   Gene: ENSXETG00000018919   Transcript: ENSXETT00000041039
Sequence length 331
Comment pep:known scaffold:JGI_4.2:GL172706.1:24458:49301:-1 gene:ENSXETG00000018919 transcript:ENSXETT00000041039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFNKGPAYGLSAEVKNKIAQKYDPQVEEELRLWIEEVTGMIIGENFQQGLRDGIILCN
LINKLQPGSIKKINEAKLNWHKLENIGNFIKAMQDYGMKPHDIFEANDLFENGNMTQVQT
SLVSLAGLAKTRGFHTSVDIGVKYAEKQKRQFGDEKMKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMPAPGTRRDIYDQKAILQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPIIHNGSQGTGTNGSEISDSDY
QAEYPDEYQGEYPDDYPRDYHGQYSDQGIDY
Download sequence
Identical sequences Q6P3P3
ENSXETP00000041039 8364.ENSXETP00000041039 NP_989257.1.99540 gi|39645383|gb|AAH63914| gi|45361359|ref|NP_989257| gi|49522472|gb|AAH75515| ENSXETP00000041039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]