SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000041498 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000041498
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-24
Family Calponin-homology domain, CH-domain 0.00051
Further Details:      
 
Domain Number 2 Region: 676-759
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000868
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000041498   Gene: ENSXETG00000004710   Transcript: ENSXETT00000041498
Sequence length 1303
Comment pep:known scaffold:JGI_4.2:GL172649.1:2232418:2343977:-1 gene:ENSXETG00000004710 transcript:ENSXETT00000041498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWNENPEVSCDLAYSEAQRWIEEVTGKNFGNKDFRSALENGVLFCDLINKIKPGIIKKI
NRLSTPIAGLDNINVFLRACETLGLKEAQLFHPGDLQDLSSRVTVRPEETDRRLKNVLIT
LYWLGRKAQSDSYYNGPYLNLKAFEGLLGQTLIKALEESTSSKRSGRDSGCSDLWYSEQR
DSLTSPPIHKRDDSWDSLDSFGSKSYTSFSSDTTIKGSSEGGESETESELTDKMQDSSKD
DMSYRRLSAMEPKATTTFNKFLPNKVKQFNYMPAPLRKKRIDKNEDNRRSWASPVFTEPD
GTFSRLKEKLSINSGSKSLEAITADELISNRQVRFEELQKIRTQLQDQDQKWQDDLAKWK
SRRKSFTSDMQKKKEEREELEKISYESPERTYKTFREMQQERETRNQDNYYMSKESSEDR
KMYSSNDDVFGDAPSKRMLERSYTVAVEAPYSMGKGTSSVQNKENDRGVISELLPTSNST
FETDGTYSSKANTSYVEQGPENSNTKTSRSLFERTYTVESGAPYSNKKETIHSITSYEKQ
DNGPPMNSSSLLGEQHSYSSFVTESKPIPGLASLPRSYQKNDTSRITSVVTPRPFGIQSK
GITSLPRSFTVDDSFKYNGDLGSTKNNSAFNSYIKVEEKPNRIKRSEENDEPDEKESIRR
SHSPKPFPGDQYSDLRISINQKPGSSLDFGFKTSWNSSGVFVKSVDIGSPAEFCQLHVDD
EILSVNGTKVSSMDYNQWVEAMDHAVETGNLAMDVRRYGKNDWGRDPPSLPYKSHKTLNL
TSMDTKLIGSPENKWIDASRSQSTSLKKDVPDSGNARSQLNGIQDSTPKGSSDSSLLDMP
VPSINVSTRRSWDPEDERKRQEKWLQEQEQILQEKYKREQEQLREEWERAQQEAEKERFH
QIQQEQVHSSLPITSQSSYWKTFGSDLHSSEEENRQKESSEEELESERQWKRAEEERLKY
LEAQRHHEVEEQRRQLEEETNRRQTEEENRRRQAEEENRRRQAEENERKRQEEERKRKEE
EMRLQRAAEEERHQKKLQEEEQKQNASERIYGRNNVGLESDDYHTPGNGDHTDSGTSEDT
GNVQQRPYREQLQGSAEVERQRIIQEMRKKAPLNNDNSWIRQRSSSMTKEASTLPNYMRR
GESLDNLDSTSGLQRVSPWANQSSSYNSLSSSQDFSRPSQVVSTSNRTFLRNSSNSLPQS
AAGPSKSASLPQSSAVSQTSNQQRNKSVSGKKLCSYCNNSLGKGAAMIIESLGLCFHLHC
FKCVACETDLGGSESGAEVRIRNSELYCNSCYIKFKMGQPTSM
Download sequence
Identical sequences B5DE77
ENSXETP00000041498 gi|197245638|gb|AAI68559| gi|213982997|ref|NP_001135659|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]