SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000041596 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000041596
Domain Number 1 Region: 383-701
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.01e-42
Family Rhodopsin-like 0.00092
Further Details:      
 
Domain Number 2 Region: 92-371
Classification Level Classification E-value
Superfamily L domain-like 1.45e-34
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 3 Region: 25-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000041596   Gene: ENSXETG00000019186   Transcript: ENSXETT00000041596
Sequence length 735
Comment pep:known scaffold:JGI_4.2:GL172716.1:1541358:1597443:1 gene:ENSXETG00000019186 transcript:ENSXETT00000041596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLLNMFIESQSTDYPLYTDSITDPECRMGFFPCGNVTICLPRTFHCDGVKDCENGADEEY
CGDNSGWANIFYEVHGKTNDVIEPQECCLSRFPESCECKDTELECVDVNLEAVPYVSSNV
TLLSLKRNKIHALPDEVFIGYHDLTKLFLQHNCLRNISQKAFFGLYHLQRLYLSNNCISY
LQQGIFSHLRELKWLILDENPIIRISQDIFAGLTSLFFLSVIIDKNKVVPTTICPFHVSL
GLWDFEGNRIKTLESSSFVTCNELTVLFLRGNQISLVKENIFSSLRSLAEMPFSSCNFLN
KNNIKFHNLFACLNLGCNPLSLYTEQFESLQHLQSLDLEKIEIPNISTRMFQPMKNLSHI
YFKKFRYCSYAPHVRVCTPLTDGISSFENLLANTILRVFVWVIACITCFGNIFVIGMRSC
IQSENKTHTMSIKVLCCADCLMGIYLFFIGVFDVKYRGQYKKYALLWMESLQCRSLGFLA
MLSTEVSVLLLTFLTLEKYLAIVFPFSNIRPGKRQTLIILISLWAVGFIIAIVPFWNEDF
FGNYYGKNGVCFPLYPDQTEEAGGQGYSLGVFLGVNLLAFIIIVFSYISMFCSIQKTALR
TSEVNSHIHTDVAVANRFFFIVFSDAVCWIPVFLLKILSLFRVEIPGTVTSWIVIFILPI
NSALNPILYTLTTSFFKEKLKQLLHRQRRRSVFRNERKSLSTSLVWTEETLVQHPSLKLG
FLHKKSLDENIIKTT
Download sequence
Identical sequences F7AYQ3
ENSXETP00000041596 ENSXETP00000041596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]