SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000042340 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000042340
Domain Number 1 Region: 185-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-55
Family DBL homology domain (DH-domain) 0.00000105
Further Details:      
 
Domain Number 2 Region: 3-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-36
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 377-539
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-32
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 4 Region: 651-752,804-830
Classification Level Classification E-value
Superfamily SH2 domain 1.77e-26
Family SH2 domain 0.00076
Further Details:      
 
Domain Number 5 Region: 756-832
Classification Level Classification E-value
Superfamily SH3-domain 3.4e-20
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 571-645
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000144
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000042340   Gene: ENSXETG00000019578   Transcript: ENSXETT00000042340
Sequence length 836
Comment pep:known scaffold:JGI_4.2:GL172773.1:250935:403674:-1 gene:ENSXETG00000019578 transcript:ENSXETT00000042340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGWRQCGRWLIDCKVLPVDHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKD
INFRPQMSQFLCLKNIRTFLKVCHDKFGLRNCDLFDPFDLFDVRDFGKVIAALSKVSYHN
IAQTKGIRPFPSEDTAENDDDIYRSLEELADEHDLGENDTYDVPCEEDDIYEDIIKVENQ
QPMKMGMTEDDKRNCCLLEIRETEDRYYRTLEDIKTYYMIPLKQILSVQEISTIFINLEE
LIKVHFNFLRTIELSVMSGGSTIGQVFLDYKEKLLIYGEYCSHIEYSQKTLDQLIATRED
VRTKLEECSLKVQEGKFKLQDLLVIPMQRVLKYHLLLKELLSHTADSPERQTLKEALDAM
QDLAMYINEVKRDKETLKKISEFQNSIENLQVNLEEFGRPKIDGELKVRSMVNQAKQDRY
LFLFDKVVIVCKRRGYNYELKEIIELLCHKMSDDPMNNKDVKKWSYGFFLIHLQGKQGFQ
FFCKTEEMKRKWMEQFEMAMSNIKPDKANANHHNFQMFTFDKTTNCKACKMFLRGTFYQG
YFCSRCGVGVHKECLETIHACKIGNIYLYPDNMLVACWPKMVAVQNYFGNPAPPGKPVLT
FQKDDVIELLRGDPNSQWWEGRLLLTKKSGYFPSSSVEPCPVEPLVIRSDYSKYPWFAGN
VERPQADNLLKGHVSGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKNNWIHITEAKKF
ESLLELVEYYQTHSLKESFKQLDTTLKYPYKSRTGRSSSSSSSNTPRAPVFTPRPVGTAI
ARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGVQ
Download sequence
Identical sequences F6WZD6
ENSXETP00000042340 ENSXETP00000042340 8364.ENSXETP00000042340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]