SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000045573 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000045573
Domain Number 1 Region: 24-163
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-25
Family Calponin-homology domain, CH-domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000045573   Gene: ENSXETG00000021088   Transcript: ENSXETT00000045573
Sequence length 376
Comment pep:known scaffold:JGI_4.2:GL172695.1:2139551:2279251:-1 gene:ENSXETG00000021088 transcript:ENSXETT00000045573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSATLQGEEIPPPQESPPDTACREAQKWIEQVTGKSFGDKDFRTGLENGILLCELLNA
IKPGLVKKINRLPTPIAGLDNITLFLRGCKELGLKESQLFDPGDLQDTANRTTARNSDCN
RKLRNVLITVYWLGKAASSCSSYSGNNLDLKEFEGLLAQMRKENEEIESPKRSIRDSGYI
DCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSQQTPSPDVVLRGSSDGRGSDSESDLPHR
RLPDVRKDDMSARRVSYGENKAFVPFNQYLPNKSNQTSYIPAPLRKKKAEREDYRKSWST
ATSPLGGERPFRSMSMCDMRYEEEGSMQPHSRAHYEHLQHVNSLLKEEDDTWQDDLAKWK
TRRRSASQDLIKKEEQ
Download sequence
Identical sequences F6ZAR4
ENSXETP00000045573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]