SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000046585 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000046585
Domain Number 1 Region: 204-265
Classification Level Classification E-value
Superfamily BPTI-like 5.96e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 2 Region: 332-393
Classification Level Classification E-value
Superfamily BPTI-like 1.06e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0038
Further Details:      
 
Domain Number 3 Region: 284-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000046585
Domain Number - Region: 176-205
Classification Level Classification E-value
Superfamily PKD domain 0.0381
Family PKD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000046585   Gene: ENSXETG00000021555   Transcript: ENSXETT00000046585
Sequence length 485
Comment pep:known scaffold:JGI_4.2:GL173137.1:105219:126636:1 gene:ENSXETG00000021555 transcript:ENSXETT00000046585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GETCLDKFTKGFHDFVLDLDYSVKSGATFLSSPPLHSGRDCMTACCRTLGCNLALAQETD
NGEDVINSCFLINCVYEQEFVCKFIRKPGFVNFITMDVYNKYQAMMEQVGIGGRLLYRLA
SVWPFGIDKISTLLNIYLKGFLVLQDMRGTEWREVPGDSQVQCRRLYKEKMTLWGRGEGP
YIFQLVVTDTAEQQNSATVTITVLSTAETEEHCFAPHKVGRCRGSFTRWYFNPETNDCLE
FTYGGCKPNKNNYLRIEDCRQTCRNNSDHSGKSSRRLHPVCDGHCSPNQFQCAQGCCIDV
GLECDEHQDCPDNSDELFCENYDKGFKKLQTFEIPNSKARCVDLPDTGPCRASFSRFYYD
PNIRKCLRFTYGGCAGNDNNFHRESDCMRYCEGVSERDIIGRRLGDTEAQKEGSVKSFVH
GAGSAEVAAAVFLGICILVVLAVIGYCVIKRRKSSRRRQPVANTNTLATTEDTEHLVYNR
TTKPV
Download sequence
Identical sequences F6RCL0
ENSXETP00000046585 ENSXETP00000046585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]