SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000046684 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000046684
Domain Number 1 Region: 155-269
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-35
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 3 Region: 321-432
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.67e-24
Family Frizzled cysteine-rich domain 0.00026
Further Details:      
 
Domain Number 4 Region: 270-310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 113-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000046684   Gene: ENSXETG00000021602   Transcript: ENSXETT00000046684
Sequence length 435
Comment pep:known scaffold:JGI_4.2:GL172760.1:679605:683563:-1 gene:ENSXETG00000021602 transcript:ENSXETT00000046684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGTLNDPEGSFNSPNYPYLYPPNSHCSWFLEAEPGHLVQLKIIVLDVEGYGSCLVDWLE
LSDGNITSRFCGSVAPTTFISHSHWLHVVFVSDGSVGATGFLATYRMIKPSQGSCSWDEF
LCDERRCILLPALCDGLADCADKRDEENCNQTNKDCGGLLNSMQGSLQSPNHPGFYPGKI
ICRWLLSVQDGLIIKLQFHNFSLESDLRCRFDYVEIHDSAGLGTPSLMGRFCGSQVPPTL
TSSGAQMTVLFVADEVTSGLGFSATYEAINITENECNPKELRCGSGECLSLQWACDGWLD
CPDGRDELGCPETPDIKPEVPCQPVQVPMCQGLSYSQTAFPNLWVSLHEQQAASELLTGY
KILQELPCFPVLRPFFCALLVPSCSAEGGVLQPCRSVCVNAEQHCLAQLHQLGLAWPFNC
NLLPPHAQQPDCVIP
Download sequence
Identical sequences F6XHR8
8364.ENSXETP00000046684 ENSXETP00000046684 ENSXETP00000046684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]