SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000046700 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000046700
Domain Number 1 Region: 1434-1568
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.57e-57
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000033
Further Details:      
 
Domain Number 2 Region: 227-338
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000589
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000046700   Gene: ENSXETG00000021592   Transcript: ENSXETT00000046700
Sequence length 1574
Comment pep:known scaffold:JGI_4.2:GL173944.1:3970:36547:-1 gene:ENSXETG00000021592 transcript:ENSXETT00000046700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVGLSASGDGTRRKMESLADGTVEVVPLDMYDSFRAKIAANLQWICAKAYGIVDVALS
AHNRMAHPIYSLSHDSPRLSLCLSERNTRLLACSIAGTALAELQFPASSIIILSRFQAVC
VLKASAAPWDNICLPSAAFAQSAHMSMIDALMMAYTVEMISIEKVVASVKRFSTFSASKE
LPYDLEDAMVFWINKVNLKMREILEREHRIKQQVIESPSHPKIRYRRDHPSNRHLPYFPI
LEDLMKDISDGAALLTIIHFYCPEQMKLDDICLKEVTSIADSLYNIQLLKEFSNEYLNKC
FFLTLEDMLYSPLVLKPNVMVFIAELFWWFENVKPDFVQPRDTQELKEAKVATQPKSSRP
QVPISNATKRSFLASPPSTGDCQAAAASDSCSRNYLQPEDAENGKGCTVFSPSHPLLPLR
QKQQKSVQPEESPSKSNSHKQIRPITGEHQGAGISSGDQKRDKPLSQPFGFHHGADDVDA
TSGDSISLARSISKDSLASNIISATPKHQTFPTPMNVGSKSLLGNVDIEDDEEELVAFIR
SDDTSCPGDLELQSVSSRASSQMSATRPRRPGDLESKPDSFFLEPLMPAVLKPAKEKQMV
PKREEYGEGKQKGFSSKRQNEGNQSFSRKKIINNHTGHDLNRTFTPLSSLESACVTAPLR
TDPAQLSIENGNGTFRPLATSSVEPNEPVGGFFLHDINDDEVEEKPSVGSLMIEDPRKSD
TTWTVLPDSEHLDIGEREQEVVVARAFGKHIGEEESAKLQEDMKVKEHDDKDDASGRSSP
CLSTISQISSASMASGSIRMTSFAERKFQRLNSYETKSSTSSSQKTTPDGSECCPLPLTT
WKQRREQSPGRQNKDHANVLASELVQLHMQLEEKRRAIEAQKKKMESLSARQRLKLGKAA
FLHVVKKGKPDTVPQPVKPGHSLKDYTKRVPEDIDAVSVNAKVEQYLETIEPGDLKVQEA
FADPKQKDPASLEADICNLIASSTPDDADSEIDVNECDLSIEKLNETISTLQQAILKISQ
QQEMLMKAPAMAVPPLPNNGQEHKLKPSVQFVEPISPPGVPVARKTPRFGQGRNPRSLRI
PEQKTAKEKALSSSRVITPTNSIETVPHLKSVQPPKSPNLPAEEPPADIVPEQDKPTTGG
FRLHEDNNQRTFVLSASKDANIISEQMHREAVASLRVAGGSAPESSGKENVPVDEQNKNK
SSLIEVDLSDLKETDEEGEETDHPEKTKDIISDDQKSGLGFFFKDEQKAEDELAKKRAAF
LMKQQRKAEEARIRKQQLEAEVEQKRDEARRKAEEDRIRKDEEKARRELIKQEYLRRKQQ
QILEEQGLGRPKPKPKPRKTRPKSVHREESYSDSGTKYSSTPDNLSSAQSGSSLSLASGA
TTEAESVHSGGTPSHRYTQGSGYSMNRKNIRLSRNMTFTSVDCVDSLSFFLFPSGPKLYK
EPSSKSNKPIIHNAISHCCLAGKVNETVKNSTLEELEKCDSNHYIILFRDAGCQFRALYS
YYPDTEEICKLMGTGPKNITKKMIDKLYKYSSDRKQFTVIPAKTMSASVDALTIHNHLGK
PRGPXLPKKNPLCK
Download sequence
Identical sequences F6TMK5
ENSXETP00000046700 ENSXETP00000046700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]