SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047077 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047077
Domain Number 1 Region: 108-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000812
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 27-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000111
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 67-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047077   Gene: ENSXETG00000007552   Transcript: ENSXETT00000047077
Sequence length 339
Comment pep:known scaffold:JGI_4.2:GL172917.1:1013846:1069330:-1 gene:ENSXETG00000007552 transcript:ENSXETT00000047077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRIQTTLVHFPTESQLLPGNNHTTECNIPGNFMCSNGRCIPGGWQCDGNPDCFDESDEK
ECPRARSRCGPNFFPCTSGIHCIIARFQCNGFEDCPDGSDEENCTAHPLLCSNSRFHCKN
HLCIDKSFVCDGQNNCLDNSDEEHCHSPQEPGSEQDYVSSENQLLYYPSITYTIIGSSVI
FVLVVALLALVLHHQRKRNLMSLPVHRLQHPLLLSRLVVLDHPHHCRVTYNVNNGIQYMS
GQGYQQPVSVESPPSYTEAVLDHSSRPPWFDLPPPPYPSDMESVSQTELPPYRSRTGSSA
SAGSTEHPRGTPCGTESPTEPQDPTAAPSDDLPSTEVDV
Download sequence
Identical sequences F6T6Q7
ENSXETP00000047077 ENSXETP00000047077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]