SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047447 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047447
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-34
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047447   Gene: ENSXETG00000028015   Transcript: ENSXETT00000047447
Sequence length 97
Comment pep:known scaffold:JGI_4.2:GL173832.1:57060:57350:-1 gene:ENSXETG00000028015 transcript:ENSXETT00000047447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVLTQSPDYVSVSPGETVTFTCKTSSSVYGFMAWYQQKSGQAPKLLIYLASTRHTGTPE
RISGSWTWTDFTLTISRMEAEDAADYYCQQYDSFPLT
Download sequence
Identical sequences F6PMQ5
ENSXETP00000047447 ENSXETP00000047447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]