SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000048946 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000048946
Domain Number 1 Region: 38-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000157
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 243-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 205-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000864
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000048946
Domain Number - Region: 178-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000048946   Gene: ENSXETG00000022617   Transcript: ENSXETT00000048946
Sequence length 548
Comment pep:known scaffold:JGI_4.2:GL173428.1:262002:264509:1 gene:ENSXETG00000022617 transcript:ENSXETT00000048946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPQNYFLCRSRCLPLSSRCDGFFDCEDQSDEIGCPPHCSFTLLEFYGVFSPPGYPDSPPN
PLPTSCRWLIDSGDSRGLFLQFSSLQLSGSDALVVYELDAGDPNRILRALDQQSNGKSVT
VESVGGRVMVVYHYSIWFSAFRPRGFNATYRVRGYCLPWDHPCGSSPGILWDDEVEEGGG
CYTEAQRCDGAWDCANGRDEMNCSGCAPGHYPCAMTRACYPITERCNYQTSCQDGTDERG
CRACQPGGFHCDLERCVYEAWVCDGQADCRDGSDERGCGYTLPRKVIAAAVIGSLICATL
LVVALGCTCRLYTTRAREYSVFAPLSRMDAELIQQQAPPSYGQLIAQGAIPPVEDFPTEN
PNDGSFMGNLRSLLQFLHQAPPVPAGAVNELPPRRRPPRAVRRLLRRLRRWGLLPPRAQG
PQVEVCQNQTSPSPEVASEGTETPTAPALPVKMPLDCPDTSSAQTEASTLPQYSGSGRGL
MGMMQVMRERILHPLGAEDTSDGRRGRERPEEEVGEDLQRHEEDDEMWGLLPLAEGWDSE
AGDVGLIV
Download sequence
Identical sequences F6X6X5
ENSXETP00000048946 8364.ENSXETP00000048946 ENSXETP00000048946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]