SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000049402 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000049402
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.62e-59
Family Calponin-homology domain, CH-domain 0.00000801
Further Details:      
 
Domain Number 2 Region: 1667-1850
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-41
Family Plakin repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 1469-1661
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-30
Family Plakin repeat 0.00074
Further Details:      
 
Domain Number 4 Region: 5909-6067
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-28
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 186-302
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 6127-6286
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-26
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 5031-5183
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 5710-5849
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-23
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 9 Region: 6392-6508
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 5479-5627
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-21
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 6862-6941
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.14e-20
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 12 Region: 6500-6613
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-20
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 13 Region: 4597-4752
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 14 Region: 6571-6696,6726-6753
Classification Level Classification E-value
Superfamily Spectrin repeat 4.57e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 15 Region: 4266-4391
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-18
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 16 Region: 5186-5303
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-18
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 17 Region: 3819-3958
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 18 Region: 5361-5518
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 19 Region: 6256-6351
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-16
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 20 Region: 620-722
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000158
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 21 Region: 6773-6853
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000169
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 1153-1286,1313-1335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000227
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 23 Region: 4810-4968
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000202
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 24 Region: 4171-4282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000082
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 25 Region: 3568-3697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000314
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 26 Region: 5625-5738
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000108
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 27 Region: 4395-4517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000936
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 28 Region: 527-618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000051
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 29 Region: 3708-3814
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000102
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 673-801,922-942
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000259
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 4017-4137
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000259
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 32 Region: 4507-4611
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000198
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 33 Region: 3330-3447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000113
Family Spectrin repeat 0.009
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000049402
Domain Number - Region: 3945-4028
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00176
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 985-1089
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00907
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 3093-3194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0118
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number - Region: 5308-5380
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0132
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000049402   Gene: ENSXETG00000022769   Transcript: ENSXETT00000049402
Sequence length 7150
Comment pep:known scaffold:JGI_4.2:GL172750.1:189250:355627:1 gene:ENSXETG00000022769 transcript:ENSXETT00000049402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PREKGRMRFHRLQNVQIALDYLKKRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISD
IHVTGESEDMSAKEKLLLWSQQTSEGYGGIRCENFTTCWRDGRLFNAIIHKYRPDLIDLD
TVAVQSNITNLENAFYVAEKLGVTRLLDPEDVDVSSPDEKSVITYVASMYDAFPKTPDGG
EGISANDVEVKWIEYQNMVNYLIQWIRHHVVLMSERTFPNTVVELKALYQQYLQFKEKEI
PPRETEKSKIKHLYTFLEPWIQFGRIKLVQGYHPNDIEKEWGKLIIAMFEREKAIRPEIE
RLEMLQQLATRVQRDSLGCEDKLILARSALQADAKRMESGIQLQNEAEITGYLIECENLL
RQQLVDVQSLVDGKYYQADQLVQRVASLRDELLALRNEFTSLYSKGRMFTNDQTKLMISG
ISQSLSSGFSQNLNPVMNSTLSHSMTPSMTPTSLTPGLSQGFNSHLTAAMTPPFSPNYNS
GLIQNYATGMNTNALQSLKLMQIKKPLQKSSLADQNLPEEEVNSKFVQDLLSWIEEMQVQ
LDRAEWGSDLSSIEGHLENHKNFDRAVEEFESSLKEAKMSEPQITGIFKANYDESLYKLE
SQYSKLLNSSRNRQKHLDTLHSFVSRATRELIWLNEKEEEEVAYDWSERNQNIPAKRDYH
GDLMRELDHKEEIIKSVQDIAEQMLLQNHPARSTIEAYRAAMQTQWNWILQLCHCVEQHI
RQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEKEQLLQYKS
TVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQIEITIYKDDECILASNSHRAKW
KVISPTGNEAMVPSVCFTVPPPNKEAVDSANRIEQMYQSVLTLWHESHINMKSTVSWHYL
MNEIEGIRASKVSTIKTLLPGEHQQVLSNLKSRFDEFLEDSQESKIFSMSDIAQLEREVN
VCKLYYEELLKSAEREEQEESIYNLYVSEIRNFRLRMENCEERLIRQIRTPLDRDDLHES
ILRISEQEKLKKDLDHLKADLSSISEKCDEFFSQAATSPSIEALRTELNVVIQNMNQVYS
MSSIYLEKLKTINLVLKNTQGAETLVKLYETRLCEEDAVTADRNGIDKLVATLKLWRSEV
DEKREVFHALEDELQKAKNISDQMLKVHKERDLDFDWHKEKADQLAERWQNIHSQIENRL
RDLDGISKSLKYYKESYGALDSWIRQIEETQSMLQENMPENSKALAKQLDQQKMLISEIE
MKQSKMDECQKYSEQFSSAIKDYELQLMTYRALVDSHQKSPMKRRRIQSSSDSVVQEFMA
LRTRYTALMTLITQLVKFSGETLKRMEEEEKSLEEEKKEHVKKAGEILNWVSKVTQTLSK
EGGQDISENTPISKSQISCDDIAMKQEEISDALQTLQLLLAKHSERLTEEERKEIEKQVK
ELQESQSFLSKEYERQQKEAKDLVDKLVEQKVDKVVSGTIDETTGTVHSVYHSIVQGLVD
YETGIRLLEIQLIVSGLVSPELKMCFDIEEAKNHALIDEQIALRLQDLSDAKNIYSSLSS
VDFPIIDAFDQGLISESVTIKMIDILLSCGCLYVSGIGEHLNLNKLFQRNLISAVLFSKL
IDRQKAGKDLIDPITAEKVNVTEIIQRCVTNKQTGMKFLPVNSQDKGKITIKSGRKISVL
RAAHEGILEREIMFRMLGAQIFSGGIIDPDSGKRFTLEEALEKGFIDQCTVCGILTQQVQ
NGGIVCPSTGKYLSVDEAVQCNLISYSSALLVLEAQRGFIGLIWPDTSEIFPVSTSLQQG
MISNDLAQKILRNRQKIAGLYIPETSEIIHLDVAAQLGIIENNTATVLSNVQLHDTMPNI
DVLEPTCKHALKWMSPYESHASPLDELSEKKSSDTEEPLTHNPEHTKQLFYSYLMINSYI
DAHTGERLLLFDGDLDEAASMLLESEHIVRTTSMANEEQTFDSICNEFSSHVTGLDIHNT
ELDILGQFSEKEPNNSSCEENIPITSVADLDESLCQKQLNTSVKSDLDCNDICQEQLKSY
LGDIENTGVCDQEKKGKAEHDQCQELHFVENKQKHVLKPLESSTEKGNLTHTHIEEDSLN
IPEMQHYLVNDIVESAEPHHLMPGNILHEESITAVNVQIEEQQIVTKDPVPLFNTEPDEI
ETQVNSVSNMSSDNESRNTEPHLSNSNYPINGNEGYETTQHEVIDSDGYLTPTNTEHDDV
TLNTVVEFHSNSDIAEICTLNINDNLTHTTSSNENYEFYSPEHVVKRACGTSQGHSDNDT
SDLEEEGSDDEVDFNSQYDLISNKMQAIGGNTAEDRDLTDSSSDDDTFYYNESDIEKAVV
ARDRQFLETIIEEDLESNTCSEEQASPVTDGASSVNLVEDRWKDGEHEADGTEVDNKPNN
FKNGSNCLTNEEKEDEFTESCFSETDIECFVTDETNSDEDFETELSTNEQSIFSNTNVFD
PCLEGERPINFSNSICTSFQANNSENTEFVSLKPSKNVYSTELDDEDNREGKCSTDNTPD
SVLRTYPSFETTTVECAESGVVKHKTCEILQTGKDLNLNLSVSAIPDVNAEMSELCKLVT
LESTLLENNDLATNTTSSLCEPSEHPNNTEKESTSISAPNLDDCILQADKKTTIFKTNDN
VEEIIHLPEKQQNTDCLSTPSPIHIENLSAIFDASFPKAANDVLESNSMKDMSQTLNTSS
IKDTDPKYEEKNRDLTSYLRGCASILQANEETAGTPCSEADMSFDENNTNDRINTRLNND
MPEFPDMAITDLKEKVGGEQVHIYVETVPEDGNIEQDNCYEEKANMGKSRVCDIMQPKEE
FTNNSDLSEKANESLVESQLIEETQIGHNSTACVYAVQNEKILQSEPDYPDSNLNNASST
TEVKEVTNNSHAVLDLHSGSSGTNLDENQLCPNQEVEKLSSDFAYATEPVAEPNRPKLIS
SQLEQIFYEPPDSENKNKIEELLININKGLFPSEMVSYSLKSHSSERQDDNSTVNAARQS
DNFAEAQCALTFKHASQNPETLPSNYDQKTDDYKTQPNPQDMSKTDEAKGCLSSDTVLGG
VKHGQQHKVLTQGAGHSNAPDKSTGSLSMTVSQCSQKLCEHLTVIQDLKYHLDSLPAISD
NLETLKIQLEQIESFASRLNVLSVDMKKDLKAAEPFLMSMPGNIATEHLKELNDCLKKAH
AVVCEMSSDRAKQIAFNVDTEMSKLSVFYQDLLNRLQLLSDWIQEKQNSMDVSVNSNGAE
MEKQSLEFLKELGTHISEKKLELETTAFDIQFFISEHAQDLSAIQSKQLLRLLNTTQRSF
QEAHKTIASQTKYLQSALLAAQDLSDQKDAEVQLQEHKEKLQEICHLLTQTENRLIGQQD
TFSAHDSPADLKLHQNEYQELQKDMLAGASELAEIVKNTEKFLQEYGDKLSPEDRAIIEK
KLKEAKNKFDLLSKRAEESKKQLDKALTSAIKKESEKSAAVEQLEESKNKIESLLDWLSC
VDKEAVNGNNVPKTNVKQNGTHHQDQDLSSLLHGTEEVNGNLIQRDGKESTVNVHKQDKE
DLSSQYQRAKAQHDKIVSQHQAVIIATQSAQALLEKQGGHLSKEEKVKLQKDIADLKAQY
ETALCDSERKMKLIQNVQEELEKFSTDCNEFENWLQESQGELEELESGPADFAAIDIKYQ
RQKSFSEDVISHRGDLRYITISGQRVLDAAKSCNKDEDNNNVSTLETCKMVQEKLDTASE
KFKSLQSKCNVLGNNLKDLSDKCQHYKDASSSLLKRLEISESTVNKKLSEPIAANTKNVQ
RQIDETKVLCEQVSAHQADVEKLKKAAEVLMDSKGGLSLNKDEIQMPLDDIVGRYNTLSQ
SVNDWNENLQVTLTRSLSVQDGLNEMLDWMCGVERDLKDQHQVPLNSSSIQEIITKNNIL
EQDISNRQSSINTINDKVQKFMETADPSTASSLQAKMNDLFCRFSKAGELAKERTAQMEG
LKMKVELFENLSDKVDLFLDQKFQSLTETDVPGKDVTELSQYMQETSCELAGHKKNLEDL
QKLVEEICVYGIPGDKALALEKVKTMLKRFQDLEETVKAKEEDVSSCQNEMDAFKSLIQS
LKKWCVSVTEEIPAAPRTLCVEELAKHLQKSKSLQEEWSQKGPEVQEVNSKGAVLSNLIS
TVTSPVKIRASGKSGTVLYVMTVINGTAKEQLTNKELAYVQKEISDVNEGYQHLGDLLKE
KVSELERWLLQMQQVQEETDTLMKWLSKMQDETAQWEHPTDSVSLKAQIEQHKRFASDMK
QKEKSVEMLKNKLKDLLLANPDAPESSKWKEMLDKIDSLWQDINKMAAERQQTLEESSND
LNQFQTAEAQLKQWLTEKELMASVLGPLSIDPNMLKTQKQQVQILLKEFDARKQQYEQFR
SAGQRILNRPCELPSSGEVVKEQLASVACKWESLTGQLNDRCDRIEQAIVKSTNYQNNLK
GLSEKLSAMSNTLSTNMVVSSHPDAVNQKLQTAKQLQKDLSNEKKNIEDTKVLCQELSNL
VAEDYLKAELNRQMDTVVKPFVDLEEKAGYHVEQLQMAFASSQKFHHLSEDLKSWIQTKT
KEQNEAAPISANLNILESLITEQAEVQNALKDQLSTYEKVTAEAENLLQKTKGDEKANLQ
SQLSMLKSNWEAINKQVLERQNNLLDCQQKATKHKEFVENIQPWIEECQHKLSEFTVSVD
LSAIESSVGQVKVLQKNVDKQRGMMETLNSATESLLNCCQTDKEAIREQNKNMNSQVDEL
IDNLHIKRDTLEKFGTRLKEFQESVKDTEKQLAVAQEHLDAHNSLGPQGCSNKHLTIMQT
QQKVLQNLEPQIDIVRSLAQQLVVDAFDAEGVTELVLQAESLHQKHHIIHQEVEEKCSFL
ETKLQGIGHFQNSIREMFSQFTELDDELDSMTPVGRDLNILQCQKQDISKFLKKLSDLIT
TNENANKTCKKMLATESSPDLIGIKRDLEALNKQCNKLLDRAKSREEQTENIISRTEDFY
CTLKQFFDLLKGVEEHEESQGAVGMETDVINHQLNIFMAFQKEEIEPLQARIQEVNQLGQ
GLVQSAAKNTSTESLEHDLEEVNVRWNTLNNKVAQRAAQLQEALLHSGRFQDALESLLSW
LTDTEDLVASQKPPSAEFKVVKAQLQEQKLLQRLLSDRKPTVEAIKREGEKIASSADQTD
KEKILKQLSTLERRWDELLKKAEISRNRQLDDILVVAEQFHDSLEPLSEWLTSTEKKLAI
SEPIGTQTAKLLQQISQQKLLQEDIMLRKQNVDQAIQNGVELLKQTTGDEVVIIQEKLDG
IKLRYAEITKLSSKVSKILDQALHLATQFHSTHEELSRWLDKVEVELKGYETQASSTDEL
SVVQERKKDLKQETKVSKALLDSLNDVSSALLELVPWRAREGLDRMVTEDNERYRLVSDT
LTQMVEEIDAARVRSQQFQQAVNAEYAWTEEAENKLRSLGHIRLEQDQTTAQLQVQKGFT
MDILRHKDSVDELITSADDIMNVFNEEEKQSMKDKLKNLGIKYDKICHLNAERNLQLERA
VSLVNQFWETYEELWPWLIETENAISQLPVPALDYDTLKQQQEDIRQLRELIAEHKPHID
KMNKTGPQLLDLSPEEGFFIQEKYVSADTLYSEIKEVVKKRAIYLDEAISQSAQFHDKID
PTLENLQRIAERLRQPPSISAECEKIKEQLSENKNVSVELEKLQPVYETLKKRGEEMIAR
SEGADKDISAKVVQDKLDQMVFVWEDIQALTEEREAQLLDVLELAEKFWCDHYALIATFK
DTQDLIRELDGPGVDPSVVKEQQETAEVIKEEIDGFQDELDAVISLGSELISACGEPDKP
VVNKNIDELTSAWDTLNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPP
IGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDPLSELK
LLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEI
ELAKHHVLQNDVLAHKSTVETVKKAGNDLIESSAGEEASSLNSRLESLNQRWQIILDKTE
KRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSL
FEVKEEIYKRLMQKSQQMMERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALE
VATGFHNSLQDFINWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMEL
DKTGTHLKYFSQKQDVVIIKNLLISVQSRWENVVQRSLERGRMLDDARKRSKQFHEAFDK
LMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKKISAQYFVIAQFNASGFLSPFSS
HLIQSFNCTSNFVIVAAKIWTPVCYGIKSMIRQNKLEEALLISGQFTDALQALIDWLYRI
EPQLAEDQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVK
AQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILPD
DEDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFE
EVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALI
EEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPVLDKGRGGWKRSPTPSLYPSGT
QTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRW
MNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYID
YYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGENKYRFFLGNQFG
DSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTQPLI
AKGRTNVELREKFMLPEGASQSMTPFRPKGRRSRPSSRGASPNRSNSSPNIQASPSLAAS
SITPKTTPIQGSKLRLPGYLSGKEFHSAGDSNILTTAASKVRTQFADYRRTPSRAGSKAG
SRSSSRRGSDASDFDISEIQSVCSDMPETVLNSNRPSPRASPRSGTGKPSKIPTPQRRSP
MNKPSKLTKR
Download sequence
Identical sequences F7CGH6
ENSXETP00000049402 ENSXETP00000049402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]