SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000051348 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000051348
Domain Number 1 Region: 217-503
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-43
Family Kelch motif 0.0086
Further Details:      
 
Domain Number 2 Region: 635-772
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-23
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 3 Region: 7-109
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-19
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 909-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000051348
Domain Number - Region: 836-869
Classification Level Classification E-value
Superfamily Plexin repeat 0.00324
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000051348   Gene: ENSXETG00000023806   Transcript: ENSXETT00000051348
Sequence length 953
Comment pep:known scaffold:JGI_4.2:GL173341.1:387074:458336:-1 gene:ENSXETG00000023806 transcript:ENSXETT00000051348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGYLTDGPINYKYKTKCTWLIEGYPHAVLRLRFNHFATECSWDHMYIYDGDSIYSPLIAV
LSGLIVPEAPGNETVPEVVTTSGFALLHFFSDAAYNLTGFNIFYSINSCPSNCSGHGKCT
GSSLVPSRVYCECDKYWKGEACDIPYCKNNCGSPDHGYCDLTGEKLCVCNDSWQDIDFKV
PNITGTGGFWPKSACDIKLSRIAEKRGTNKKIIPCLFCLCYSYNVESSIWNVVPVLRGPL
QRYGHSLALYQDDIYMYGGKIETIGGNVTDELWVFNISSQSWSTRTPTVLNHGQHYAVEG
HTAHIVELDNRDAVMVIIFGYSSVYGYISNVQEFYLKSNTWLVPETRGAIVQGGYGHTSV
YEPITKAIYIHGGYKALPGNKYGLVDDLYRYEVNTRTWTILKESGLSRYLHTAVLISGTM
LVFGGNTHNDTALSNGAKCFSADFLAYDIACDEWRVLQKPNLHRDVNRFGHSAVVSNGSM
YIFGGFSSVLLNDILVYKPPSCEAFRSEDQCTSAARGISCLWDKDHCVSWESVRPSRHLF
RANCRNKSAAADDRCYKNTDCASCTANTNGCQWCDDKKCVSLYSNCSVSVKNYTKCYVRN
EQICNKLTSCKSCSLNLNCQWDQRQQECQALPDTAHLCGEGWSHVGDSCLRINSSRDSYD
NARVYCHNLSGSLASLTTSKEVDFVLDEMQKYTNQSLSLQKLSPWVGLRKINVSYWGWED
MCPFTNTTLQWLPGEPSDSGFCAYLERAEVAGLKANPCTAMTDGLVCEKPVVSPNQNARP
CKLPCSLRTSCSNCTSNGMECMWCSNAKRCVDSNAYIISFPYGQCLEWQTTTCSSQNCSG
FRTCAQCLEQPGCGWCNDPSNTGKGSCVEGSSRGPMRPLGKHSSEMVLDTGLCPREKNYE
WSFIHCPACQCNGHSTCVNTNVCEQCKNLTMGKHCESCMPGYYGNPTNGGECE
Download sequence
Identical sequences F7E9B5
ENSXETP00000051348 ENSXETP00000051348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]