SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000051361 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000051361
Domain Number 1 Region: 828-951,1123-1269
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.85e-23
Family p120GAP domain-like 0.043
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000000017
Family Sema domain 0.018
Further Details:      
 
Domain Number 3 Region: 218-256
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000715
Family Plexin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000051361
Domain Number - Region: 515-549
Classification Level Classification E-value
Superfamily E set domains 0.00965
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000051361   Gene: ENSXETG00000023817   Transcript: ENSXETT00000051361
Sequence length 1339
Comment pep:known scaffold:JGI_4.2:GL172780.1:1920204:1979709:1 gene:ENSXETG00000023817 transcript:ENSXETT00000051361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQFVNAFSWERIFFFPYFVPELDNAKILSVKNPKGADLQLWGLAHLPCGSDIRRGVILSS
FHFMKSGGHFWAGIFTSQSQAMSPDKTALCIYNLTNMMKQEKECIAEDFRVGTKKQCKEN
QRKKRILPINLGPTLTHGNLSAVFAVEVQNKMVFFLGTGNGQVLKVTLDSEWKANCPEIL
FQFDNDTAVSRTIKADPVNSTYIYVAAENKIKRIKVANCESFKTYKECLSAKDPYCGWCH
SQTRCTLNAECIPSDVPGNWNGMSEEGGNYLDFLVVPIKDKQLRITAKSSNAKNTTWQCT
VQNVGTNKTLCNGVAEKNSMKCSCLVSTTGLSDNDQLGIELTNGKRSVSDVFQFKKCRQL
QNRCMECIQSGCLWCTTNATCTSPLTPCKDYGEKVELYREIVEQIYLQSNGMNWSNKIQT
DNSVQVLHAESISSDRISYLGKDILITGENLQNLYSVLLFGTSSCPAQNVEISQIVNDTH
AVLSLPKSRKEVKSICFNPKENGCSENKTINYVSLPSCFNISPNTAWHGGGRNITITGKN
MDIVNSLIVSNTLHQWRPVSILLTHLGNISQCKFLAPQFAAPTQWLNINMSVVDNTFIAC
GSLKYLENPCFTSFAVLNDIDTELELRIKKTNDNLGIQRQEMQIHIYYLNKIYDCIVYNI
TQNLKESTVFCKAKKDSRDKIDVSIMKVNVTLGNFTTILETPGFPRLYILLVLLLIPLLL
VIIDIAACLVTKRKSKEMSNKLSEQLEQLECDVIEEIRSGFAELQMDKLDMTVESVGTIP
FLDYKHFALRTFLPEIEESKNDFTEKMYENVPSPFRNRTVDENEHLHLLRKLFEKKRFLV
HLIHTLEHQSNFSVRDRCRFASFLTISFQSNLVYLTELLEVLIKDLMDQSSNKQPKLMLR
RTESVVEKLLTNWMSTCLYGYLREFVGEPLYLLVCMLNQRIHKGPIDAITCKALYTLNED
SLLWQINAKFSSLDLNVYFPNGSEENVTESIKVTVLDCDTVGQAKEKIVQKFFIKKGYNW
GFPLHDTGLVLHHGQLQKQLSDIDNTSVVLENGIIKLNTLKHYKIEDGVTVKTFKKCCKH
TPDLENSSKYCHLVLPSSQGSEQIEGEENQGKHKFQVKELYLTKLLSTKVAIHSSVEKLF
RSIWTIPTNKPPTAVKYFFDLLDSQAEIKKITDLDVLHIWKTNSLPLRFWVNILKNPQFV
FDLKKTHLLESCLSVIAQAFMDSFSISEQHLGKSSPTNKLLYAKDIPMFKEEVKNYYKGI
RDAPPVSSAELNEFLMAESKKHENEFKEDVALLELYKYIKRYHQVVLDMLEKEPGFEDEQ
KQLLDITALMEDKKKCMWN
Download sequence
Identical sequences F7E5E8
ENSXETP00000051361 ENSXETP00000051361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]