SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000052014 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000052014
Domain Number 1 Region: 108-219
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 2 Region: 340-402
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.43e-17
Family Eukaryotic proteases 0.019
Further Details:      
 
Domain Number 3 Region: 218-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 4 Region: 262-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000052014   Gene: ENSXETG00000024110   Transcript: ENSXETT00000052014
Sequence length 402
Comment pep:known scaffold:JGI_4.2:GL172725.1:751795:769840:1 gene:ENSXETG00000024110 transcript:ENSXETT00000052014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLCCIFILLCFFYINTLTSSFSGAEDVRPNKCEFTSLSCHKVFCAPWQRCVAGVCRCK
LPYQCPRNATTEVCTEGKRKLQTYCQQKSVECSNPSNVKYRFSSEAPCTDTFSVRLTGSK
ETSKGIIKVKLPTLEKELFICAKQWSLREANVVCKQLGFPRGADAPASNKDLPLVTKESP
EEHCLQATCRGLENSLAECALRKLPVEKQVAEVKCYTENRDCGSGEFKCSNGKCIPSELA
CDSENDCGDLSDELCCKDCSAGFHCKSDTCIPERYKCNGELDCISEEDESNCEVEQEPKS
EKQEEEGQESKAIQNEETGNIVNYDMDAERRLVMKSLPELSCGVPPPAAPTKITRKKRVI
GGTNAVKNQFPWQVAIKDGTSVNCGGIYIGGCWVLTAAHCVR
Download sequence
Identical sequences F6R1S1
ENSXETP00000052014 ENSXETP00000052014 8364.ENSXETP00000052014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]