SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000052035 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000052035
Domain Number 1 Region: 487-741
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000781
Further Details:      
 
Domain Number 2 Region: 47-291
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-33
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 3 Region: 316-445
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 928-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000145
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 5 Region: 850-968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000148
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 447-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000348
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 805-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000196
Family EGF-like domain of nidogen-1 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000052035   Gene: ENSXETG00000013368   Transcript: ENSXETT00000052035
Sequence length 1051
Comment pep:known scaffold:JGI_4.2:GL172725.1:620897:689109:-1 gene:ENSXETG00000013368 transcript:ENSXETT00000052035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFLLTALWPLVFDVLLLHTQGNKQWHCTGNPLPLDNERYACNTPVPFLIFSHGNDIFTI
NSDGTNLRKVVPSAGSTLQIDFIQQENRLYWLDQNRGFLQRMYLNGSKHERLRAVGKGSI
GFAIDWKHNVIFWANQQKGTIELTSRNEKRSRVLLRGLFNPKFVAIDPLEGLLFWSSNKS
WTIIQKATLDGSNVTSIIELSGALKGLTLDTDDKKIFWILSKIDREDSVIGSCSYNGDSV
MIVKNLRLSTKYHVLGVSLLYNHIYYSERKSGSIKVINKFTGKDIVSVNLKPSIMEIRNI
KVVYPVRSYSIPNSSSNQGAKSCSISNKHCTKTCEIDAENQKCHCMNGFVLSSNGRYCED
INECALWNHGCTLGCENIPGSYFCTCPEGYVLLPDNKTCHDKTPCLTEHIECSHGCVQTT
KGPLCTCPEGSVLSEDGKSCTGCTSPDNGGCSHICIMSGPGTWECDCFPGYNLQLDRKQC
LASGPRPYLMFANVHDIRRINFDGTNYESVLDSQIGRVFALDYDPVEDRMYFAHTALKCI
ESANMDGSDRKKMISGDLSTLEGLTVDAINRKLYWTDRGKSCIERSDLNGKYRKILIQEN
NIQPRGICVHPLAKKLFWTHVGANPRIESSDLEGSEREVIISKDLIWPSGITVDHLTDVI
YWCDAKKSVIESANLDGSNRQSFSQNDVGHPFAISVFEDHLWVSDWVQPSLIRIEKRNTQ
NWVRLRGNMQRPSSVVIVHPLAKPVIADDIPLPRKEKDSNNQTAHSESFFPGPLSTSNAE
MGTREAPSSRNGLLAEIMVSDDSGCIDIHCDINAHCVSSEDGPKCQCLEGFTGNGRLCHD
IDECSLHIAACNPHQTECIDTEGGYICKCKYGYIGNGLQCTDIDECSRGTHTCGENAVCT
NTEGNYTCTCTNGFPGSAADCTGKTIIRECPLAYDGYCLNGGVCIHFPELKDYGCRCVAG
YVGERCQFDDLKSWEKHVTQMKIHNVTIAVSLLLLLLILGLGSFATYYYRHQMTHRKNHF
KQETAPGTTEKPICSTSGLSRSSEPGCLGKL
Download sequence
Identical sequences F7BYK2
ENSXETP00000052035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]