SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000054254 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000054254
Domain Number 1 Region: 26-254
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.06e-63
Family Ecto-ART 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000054254   Gene: ENSXETG00000025453   Transcript: ENSXETT00000054254
Sequence length 256
Comment pep:novel scaffold:JGI_4.2:GL187559.1:869:2849:1 gene:ENSXETG00000025453 transcript:ENSXETT00000054254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFLRDVIWIRNLLSFIFWEINAKWEEPRDPAANAFDDQYLGCRTQMDLLMDEILEAEKSE
NKLLRRAWREAENVWNQQKKRKVLLDLPDGFRDRHGVALVAYSGFIKTYFNAAVSSAGES
HQFYMERFRYKSLHFYLTVAVQLLSGGCKRVRTVFSGTDSAHSAPNATAQCARFGHFVSG
YTERQQAAAFATGTVFTIRSCYGVQLERFSQFPQEGEVLVPGYELFRVSQSEEPNEFTFT
SSRRTFSNFNCALIGG
Download sequence
Identical sequences F7CBP0
ENSXETP00000054254 ENSXETP00000054254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]