SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055091 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055091
Domain Number 1 Region: 52-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000055091
Domain Number - Region: 11-41
Classification Level Classification E-value
Superfamily PKD domain 0.0157
Family PKD domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055091   Gene: ENSXETG00000017503   Transcript: ENSXETT00000055091
Sequence length 242
Comment pep:known scaffold:JGI_4.2:GL173379.1:453687:464168:-1 gene:ENSXETG00000017503 transcript:ENSXETT00000055091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPQPGTLKLSNLQEGVYNLQLTVTDTSGQKSSDNVSVSVLAEERHGTDCTGTCSRYQFIC
DDGCCIDITLACDRVIQCPDGSDEAFCQNFNSGRKTVIHISESTDKQTGTGNYFPTEIVR
TAERKMSLSLDKGKNYSLTQELHHNMLIQVESKSFDVDTDPSESDKDDEGRDSFLNHKDI
PQGSGHPVPETGAILPLALGLAITALLLLMVVCRLQLVKQKLKKARPLTSEESDYLINGM
YL
Download sequence
Identical sequences F7A5V2
ENSXETP00000055091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]