SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055099 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055099
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-50
Family Calponin-homology domain, CH-domain 0.000000185
Further Details:      
 
Domain Number 2 Region: 195-255
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.19e-21
Family EB1 dimerisation domain-like 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055099   Gene: ENSXETG00000006620   Transcript: ENSXETT00000055099
Sequence length 269
Comment pep:known scaffold:JGI_4.2:GL173151.1:37173:44659:-1 gene:ENSXETG00000006620 transcript:ENSXETT00000055099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGSVYCQFMDMLFPGSVVLKK
VKFQAKLEHEYIQNFKVLQAGFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQESAPVPVLAAPVLNKPKKPLGSGNTAPQRTVPVQRTAVSNKPPAQGI
SKKPATVGNGDDESAELIQQINVLKITVEDLEKERDFYFGKLRNIELICQENEGESDPVL
QRIIEILYATDEGFVIPDEGAPPEDQEEY
Download sequence
Identical sequences Q6P848
ENSXETP00000055099 NP_989115.1.99540 XP_012827058.1.99540 XP_017945588.1.99540 gi|38512258|gb|AAH61382| gi|45360879|ref|NP_989115| gi|60390185|sp|Q6P848| ENSXETP00000055099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]