SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055441 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055441
Domain Number 1 Region: 607-756
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-33
Family MAM domain 0.0021
Further Details:      
 
Domain Number 2 Region: 925-1089
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-27
Family MAM domain 0.0018
Further Details:      
 
Domain Number 3 Region: 759-922
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-26
Family MAM domain 0.0032
Further Details:      
 
Domain Number 4 Region: 32-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-23
Family MAM domain 0.0056
Further Details:      
 
Domain Number 5 Region: 240-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000068
Family MAM domain 0.021
Further Details:      
 
Domain Number 6 Region: 447-597
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000269
Family MAM domain 0.024
Further Details:      
 
Domain Number 7 Region: 197-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055441   Gene: ENSXETG00000003945   Transcript: ENSXETT00000055441
Sequence length 1178
Comment pep:known scaffold:JGI_4.2:GL173303.1:19367:33564:1 gene:ENSXETG00000003945 transcript:ENSXETT00000055441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKLCNFVCDQWDCSDEKHCGYHKESSLLGRAFSCDFEQDDCGWTDVSTSSYRWVRERRTF
SRWGTRPHGDHTLRNRWGWFMATGGHTGKAAATASLQSPILRNAAATCEIHLHYHIWAPD
ATTINGTLSVQLTDKTQTYNLWVGPKSSVLGWRQTVIYPGRIRGQFQLIVVSSRDPSSQG
DIAIDDLEFRHCGLSAPQLACPAGYHQCPLGPCVMPESLCDGTDDCGDNSDESNCTGHRF
CNFETDSCQWDSTAPNSWHRANGIGSKPSRDHTSANRNGEYLTAMVENGSSAELSLPTQP
SNEPCSVVLYYLMDGSDGNRLLISSQKGNEAKKVLAERQGQRGQVWLREKVTLQLPDPEH
TSDLLSGVQTSRGNAPTLTLRQRAHPIPRPTVPPYPSANVSHPIPRPTCPTLTLGQRAHP
NPRPTCPTLTLGQRAHPNPRPTCPTRFLFNNNAANWTDLSIGKLKWGADNGALPGGDTRS
KGGQYLGVQQAQGNLLVGAETRSPTLCAVGPTCAVKMTYYFNSGPAGSLSLSLWDPESGA
HSHIWGSQGESRPEWRSVVIPVGERKQQFQLVLVGSVEPLPRGDWGAAVEEIQFIDCGIK
QLTVDEAPVTCNFESGTCGWYQDPTDDMDWIMGAQGDHTTGKGNFIYVDGGSRTDRGMKA
RLLTYAQSSAGDSQCLSFYYRVWGPDAGTLILSSIIDGKETLLWTGTGTHGNRWHHESVT
LTIPTAGKYQLALDAVRDGSVGNMAVDDITLRPGACAAPTRCTFEAGTCRFKSEGQYRWK
LNQNQNANPSGPQPGPFFDHTLQSIAGHYMVVDTSSTALPRRASAVLTSDTYGALPAPGC
VSFWSQFGGDQSGTLNVYVVEGKKKEMRKLLSASRTHGDNWAYRSATIHPGGTWELRFEA
VGAGGDRGHVALDDIHISHHPCHEPAACDFESGFCAWSNVRFPLVDTYDWDSTNGAGQFL
KKTAINEDHTLGTKEGHYAFVDTGSLHTEGSSAWLTSEQLPATSGSCFSFWYRTDAGDHY
HAGELVLFMSSAQGLRPVWVLHGQHSNAWQEQQLQLDSTVDFQFVFEASKGSRPHSATVA
LDDLKYVTGRSCDAKQEQEGEHGRGGKTNAGTILAVLLGVLLGLLCGAIGYLIYRKRKKN
QAGAPSGFGPGDGVEGFDNVAFEDGPEVFSPPEITSVP
Download sequence
Identical sequences F6SQG8
ENSXETP00000055441 ENSXETP00000055441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]