SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000055445 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000055445
Domain Number 1 Region: 646-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-33
Family MAM domain 0.0019
Further Details:      
 
Domain Number 2 Region: 964-1128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-27
Family MAM domain 0.0018
Further Details:      
 
Domain Number 3 Region: 798-961
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-26
Family MAM domain 0.0032
Further Details:      
 
Domain Number 4 Region: 67-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-23
Family MAM domain 0.0056
Further Details:      
 
Domain Number 5 Region: 275-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000443
Family MAM domain 0.021
Further Details:      
 
Domain Number 6 Region: 232-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 495-636
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000332
Family MAM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000055445   Gene: ENSXETG00000003945   Transcript: ENSXETT00000055445
Sequence length 1131
Comment pep:known scaffold:JGI_4.2:GL173303.1:16381:31970:1 gene:ENSXETG00000003945 transcript:ENSXETT00000055445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASTSCLWAAFLPLFRQGRGLIKTFIYDHSCWCNPEKLCNFVCDQWDCSDEKHCGYHKES
SLLGRAFSCDFEQDDCGWTDVSTSSYRWVRERRTFSRWGTRPHGDHTLRNRWGWFMATGG
HTGKAAATASLQSPILRNAAATCEIHLHYHIWAPDATTINGTLSVQLTDKTQTYNLWVGP
KSSVLGWRQTVIYPGRIRGQFQLIVVSSRDPSSQGDIAIDDLEFRHCGLSAPQLACPAGY
HQCPLGPCVMPESLCDGTDDCGDNSDESNCTGHRFCNFETDSCQWDSTAPNSWHRANGIG
SKPSRDHTSANRNGEYLTAMVENGSSAELSLPTQPSNEPCSVVLYYLMDGSDGNRLLISS
QKGNEAKKVLAERQGQRGQVWLREKVTLQLPDPEHTDLAGAEAKVLGKIGASDLIFSPGC
KLVGNAPTLTLRQRAHPIPRPTVPPYPSANVSHPIPRPTCPTLTLGQRAHPNPRPTCPTL
TLGQLCGGFHFPLINAANWTDLSIGKLKWGADNGALPGGDTRKYLGVQQAQGNLLVGAET
RSPTLCAVGPTCAVKMTYYFNSGPAGSLSLSLWDPESGAHSHIWGSQGESRPEWRSVVIP
VGERKQQFQLVLVGSVEPLPRGDWGAAVEEIQFIDCGIKQLTVDEAPVTCNFESGTCGWY
QDPTDDMDWIMGAQGDHTTGKGNFIYVDGGSRTDRGMKARLLTYAQSSAGDSQCLSFYYR
VWGPDAGTLILSSIIDGKETLLWTGTGTHGNRWHHESVTLTIPTAGKYQLALDAVRDGSV
GNMAVDDITLRPGACAAPTRCTFEAGTCRFKSEGQYRWKLNQNQNANPSGPQPGPFFDHT
LQSIAGHYMVVDTSSTALPRRASAVLTSDTYGALPAPGCVSFWSQFGGDQSGTLNVYVVE
GKKKEMRKLLSASRTHGDNWAYRSATIHPGGTWELRFEAVGAGGDRGHVALDDIHISHHP
CHEPAACDFESGFCAWSNVRFPLVDTYDWDSTNGAGQFLKKTAINEDHTLGTKEGHYAFV
DTGSLHTEGSSAWLTSEQLPATSGSCFSFWYRTDAGDHYHAGELVLFMSSAQGLRPVWVL
HGQHSNAWQEQQLQLDSTVDFQFVFEASKGSRPHSATVALDDLKYVTGRSC
Download sequence
Identical sequences F6SQA1
ENSXETP00000055445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]