SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000056396 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000056396
Domain Number 1 Region: 3256-3495
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-87
Family Plakin repeat 0.0000000437
Further Details:      
 
Domain Number 2 Region: 3833-4071
Classification Level Classification E-value
Superfamily Plakin repeat 4.58e-86
Family Plakin repeat 0.0000000238
Further Details:      
 
Domain Number 3 Region: 2600-2840
Classification Level Classification E-value
Superfamily Plakin repeat 5.36e-86
Family Plakin repeat 0.0000000684
Further Details:      
 
Domain Number 4 Region: 2926-3166
Classification Level Classification E-value
Superfamily Plakin repeat 5.89e-81
Family Plakin repeat 0.000000195
Further Details:      
 
Domain Number 5 Region: 3592-3827
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-71
Family Plakin repeat 0.000000965
Further Details:      
 
Domain Number 6 Region: 4144-4185,4218-4413
Classification Level Classification E-value
Superfamily Plakin repeat 9.59e-71
Family Plakin repeat 0.000000298
Further Details:      
 
Domain Number 7 Region: 66-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.11e-43
Family Calponin-homology domain, CH-domain 0.0000112
Further Details:      
 
Domain Number 8 Region: 238-354
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-23
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 547-679
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-16
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 10 Region: 1113-1249
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000216
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 11 Region: 486-577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000236
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 12 Region: 4091-4139
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000366
Family Plakin repeat 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000056396
Domain Number - Region: 685-757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00141
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 1000-1111
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00195
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 819-933
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0921
Family Spectrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000056396   Gene: ENSXETG00000026876   Transcript: ENSXETT00000056396
Sequence length 4495
Comment pep:known scaffold:JGI_4.2:GL174064.1:9403:60370:-1 gene:ENSXETG00000026876 transcript:ENSXETT00000056396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WKQHRYRVNAALPSNQEATFRQRTTSEDNLYLAVLRATEGKKVAGGSLGAKQLRSWHGGH
SANEAQRHVNDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDFLKLRQ
VSTPKLSHPPQYCLSLILHPHSPLPRGSSWRDGRLFNAVIHRHKPMLIDMNRVYRQKNLE
NLEQAFGVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANEL
ELRWQEYYERVTVLLQWIRHYTVVFEERRFPASYEEIEILWRQFLKFKETDLPSKEADKN
QSKLQYQALEGAVKSGQIKVPPGYHPLDVEKEWGKLHVSILEREKLLRIELERLERLQRI
VSKLQMESGLCEEQLNQADALLQTNIRLLNAGKQPQRSGEIERDLDQADAMIRILFNDVQ
ALKDGRHPQGEQMYRRVYRLHDRLVAMRTEYNLRIKSGATQVITQVTHVTQQASRPDMDD
ATLRYLQDLLSWVEENQKRINTAEWGSDLPSVESQLGSHRGLHQSINEFRAKVERARAEE
GQFSGNRGSYQEYLGKLDLQYAKLLNSSKARLRHLENLNTFVSAATKELMWLNDKEEEEV
NYDWSERNTNMTSKKDNYSGLMRELELKEKKIKEIQNTGDRLLREDHPAKSTVEAFQAAL
QTQWSWMLQLCCCIEAHLKENTAYFQFFADAKEAEDHLKKIQDTMRRKYVCDRSITVTRL
EDLLQDSMDEKEQLSEYKGQLASLAKRAASIIQLKPRSPSNPPKGQQPVQAVCDYKQLEI
TVHKGDECLLVDNSQPYKWKVLNASGSDAVVPSVCFLVPPPNKEARDAVSRLESTHQSLN
TLWHTLSIDLKSLLSYQYLLRDIQLIQSWSLITFRSMTSEEYKAALRNLEIHYQDFMRDS
QDSQNFHPDDRMNIEREYSSCTQKYEMLLRSLEKGEQDESSCKNYISQLKNIQLQLDGCE
SRTVSKIRSPLDKDPIKECSQRIGEQQQIHFELESIQKNLDKVTEKTEKILVQPDLGSSA
PVLRSELDVTLQKMNQVYSLSTIYLDKLKTINLVIRNTQGAEEVVKTYEDQLKEVQSVPS
DLKELESNKSELKRMRGQVEGQQPLFSNLENDLSKAKEVSERMLRSHNERDVDLDRYRER
VQQLLERWQAIVLQIDIRQRELEQLGKQLRYYRESYEWLIQWITEAKKRQEKIQSVPITD
SRTVREQLLQEKKLLEESEKNREKVDECQKYAKQYIDAIKDFELHLVTYKAQVEPAASPI
KKPKVQSASDNIIQEWAQPGTTKAQLNDGLLQTATYRGQNCIQIITPPPLAHNCPCGTAL
YVDLIFSVRYLPQEGAQVPFAQHLLIPFVFGHCFYFTIEHRIIFSICFIQQELQQLKQNS
EMEIKTKAKLIEEAEINRTKVEEEIRIIRLQLETSQKQKSGAENELRELRARAEEAERQK
RLAQEEAERLRKQVKDETLKKREAEEELQRKVQAERDAAREKQKAMDDLEKFRLLAEEAE
RRMKQAEFEKERQIKQAQDVAQQSADAELQSKRMSFLEKTTQLEMSLKQEHITVTHLQEE
AERLKKQQLEAEKAREDAEKELEKWRQKANEALRLRLQAEEVAHKKTVAQEEAEKQKEDA
ERETRKRTKAEEFALRQKELAEAELDKQRKLAEDTAQHKFSAEQELIRLKAEMENGEQHR
IVLEEDLYRLKNEVNEAIHKRKGLEEELAKVRAEMEILLKAKAKAEEESRSASEKSKQML
ESEADKLRELAEEAAKLRAISEEVKRQRQSAEEEATRQRAEAERILKEKLAAINEATKLK
TEAEIALKEKEAENERLRRLAEDEAYQRKLLEEQAAQHKQDIEEKILQLKQSSESELERQ
RTIVDETMKHRRVIEEEIRILKINFEKASAGKSDLELELNKLKNIADETQKSKVKAEQEA
EKQRQLALEEENRRREAEDKVKKIIAAEQEAARQRKTALEEVERLKAKAEEAKKQKELAE
KEAEKQIQLAREAAHKKIEAEEKAYFAAVQQKEQELLQTRIQEQSALDKLKEEAERAKRM
AEEAERARTRAEHEAALSRQQAEEAERLKQKAEEEAQAKAQAQEEAEKIRKEAELEAAMR
GQAEQAALKQKQLADAEMEKHKKFAEKTLRQKEQVEGELTKVRLQLEQTDHQKTILDDEL
GRLKEEVTDSLRQKKLVEEELFKVKIQMEELIKLKIRIEQENKMLISKDKDNTQKFLAEE
AEKMKQVAEEAARLSIEAQEAARLRKLAEDELSEQRALAEKMLKEKMQAVQEATRLKAEA
ELLQKQKELAVEQAKKLQEDKELMKQQLAEETEGFQKILEEERRRQLDISTEAEHLKLQV
AELSKAQSRAEEEAKKFRKQAEEISEKLHKTELSTKEKMTVVHTLEIQRQQSDKEAEDLK
KAIAELEKEKEKLKREAQLLQKKSEEMEKAQVEQLRQETETLQSTFLSEKHILIQKEKYI
EEEKAKLEKLFETEVNKAQNLQGEKERQLKQLEEEKRLLKTSMDDAFKKQKEAEDKVRQK
QDELQQLDKKRQDQERLLEEENRKLREKLEQLEKEHKLALEKTKEITIHKETIITQTAVL
PNGRDAVDGTAQNGEQENAFDGLRQKVSPEKLLEAGILTKEMYDKLKKKVVSVQEVSKWD
DIRKYLQGKSSIAGLLLKPSNEKISIYSAMKKKLLPPGTALILLEAQAASGYIIDPVTNK
RLTVSEAVKENVIGPEIHNKMLSAERAVTGYKDPYTGEKISLFQAMNKDLIVKDHGIRLL
EAQIATGGIIDPVNSHRVPIEAAYKRGYFDEEMNKVLSDPTDDTKGFFDPNTQENLTYLQ
LMERCIVDPETRLCLLPLTDKAGKELVYTDSEAKDVFKKATVSVPFGKFQGKTVTIWEII
NSEYFTEEQRRDLLRQYKTGKITVEKIIKIVITVVEENEKKKELCFDGLRGPVPAAELVD
SKIIDKDLFNHLHQGKKSVKDVSDLEAVRKYLTGSTAIAGVQVEKTGQKLTFYDAILKNL
MKPATALNLLEAQAGTGYIIDPVQNKLMPVDEAVKAGIVGPEYHEKLLSAEKAVTGYKDP
YTGQTSSLFQALKKGLIPKDSGIRLLDAQLATGGIIDPVKNHRLPLDVAYKRGHLDEETT
KLLSESTDDSTGFYDPNSQEILTYSQLQKKCKVDKKTGHYLLPLSDQAIQAQQEEIYTDL
QAKEAFDKTTIEVPSGTFKGKTVTIWELINSEYFTEEQRRELIRQYKTGKVTIEKIIKII
ITIVEETETKKQQRLTFTGLRAPVPATELLESKIIDKTQYEKLKEGTVSVKEISETDSVR
KYLQGSDCIAGVYVEESKLKMPIYQAMKRNFLRPGTALVLLEAQAATGFIIDPIKNKKLY
VNEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISVFEALQKGLILKEHGIRLLEAQ
IATGGIIDPVHSHRVPVEVAYQRGYFDDAMSKILSDPTDDTKGFFDPNTHENLTYLQLKE
RCIKDPDTGLNLLPLKKVEKTPESPKGYSEAETRKVFEETSVDIPAGSMAGSSMTIWELM
QSDLLPPEERDRLMEEFRAGRLTKERMIIIIIEIIEKTEIVKQQELYSYDFVRRRITAEE
LYESKLITLEIYNLLKQGTKTIQEVIQIESVLRYLYGTGCVAGLQAPASKETISIYQAMK
KGFITSDVAHVLLEAQAATGFIIDPVKNELLTVDEAVRKGVVGPEIHDRLLSAERAVTGY
RDPYTEQMISVFQAMKKDLIPSDQALRLLDAQLATGGAIDPRFGFHIPNDIAIARGYLNK
DALEMMSEPSEVRSYTDPSTEEKLSYSQLLKRCHRHEKSNLFLLPLADKRKLTFKGLRKE
ISMEELVRSQIMDAVTAQRLQDGLTSIEEVSQTLQKFLEGTSCIAGVYVESSKERFSIYQ
AMKKGMIRPGTAFELLEAQAATGYVIDPIKCLKLAVEDAVRMGIVGPEFKDKLLSAERAV
TGYKDPYSGKIISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGL
FDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCMTDPETGLCLLPLKEKKRERKTS
SKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYIELSEQECEWEEVTISSSDGVVK
SMITDRRSGRQYDIDDALSKGLIDQSSLDQYRSGSLSITEFADMLSGNVGGYRSRSSSVG
SSSSYPASPAGRPQVSWSDPSEETGPIAGIVDTDTLEKVSVTEAMHRNLVDNITGQRLLE
AQACTGGIIDPVTGEKYTVADAVNKGLVDKIMVDRINLAQKAYNGFEDPRTKTKMSAAQA
LKKGWLYYEAGQRFLEVQYLTGGLIEPETEGRVSLEDALHKGTIDSRTAQKLRDINTYSK
YLTCPKTKLKISYKEAMEKSMVEDGTGLRLLEASSQSSKGYYSPYNVSGSGSASGSRSGS
RTGSRSGSRRGSFDATGSGSGSGFSMTFSSSSYSSSSYGRRYTTGAQASPMDATQ
Download sequence
Identical sequences F7ESM6
ENSXETP00000056396 ENSXETP00000056396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]