SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000056922 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000056922
Domain Number 1 Region: 5-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-44
Family Calponin-homology domain, CH-domain 0.0000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000056922   Gene: ENSXETG00000027225   Transcript: ENSXETT00000056922
Sequence length 203
Comment pep:known scaffold:JGI_4.2:GL172915.1:1408757:1443937:1 gene:ENSXETG00000027225 transcript:ENSXETT00000056922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLLIKNMANKGPAYGLSREVQQKIDQKYDNDLETILVQWIKAQCGTHAGSFDGQGKSAVQ
VWLKDGTVLSHLINSLAPGSIAKVQTSAMAFKQMEQISQFLKACERYGIPASDLFQTVDL
WEGKDMASVQRTLMNLGGIAVTKGDGYFRGDPNWFPKKSQENKREFSQDKLKEGQNIIGL
QMGTNKGASQSGMTGYGMPRQIL
Download sequence
Identical sequences F7D4E6
ENSXETP00000056922 ENSXETP00000056922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]