SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000058249 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000058249
Domain Number 1 Region: 21-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-38
Family V set domains (antibody variable domain-like) 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000058249   Gene: ENSXETG00000032373   Transcript: ENSXETT00000058249
Sequence length 125
Comment pep:novel scaffold:JGI_4.2:GL174018.1:66475:66929:-1 gene:ENSXETG00000032373 transcript:ENSXETT00000058249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFIIFFFCMFFSPSCILSQTLQESGPGTVRPSESLRLTCTVSGFELTSYGVSWIRQPPG
KGLEWIGAAWYDGGAYLADSLKNRVTITKDNGKKQAYLQMNGMEVKDTAMYYCARDTVTE
QNEEL
Download sequence
Identical sequences L7N446
ENSXETP00000058249 ENSXETP00000058249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]