SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000058546 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000058546
Domain Number 1 Region: 133-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000598
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 195-255
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000607
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 6-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000367
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 75-131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000306
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000058546   Gene: ENSXETG00000015025   Transcript: ENSXETT00000065118
Sequence length 438
Comment pep:known scaffold:JGI_4.2:GL173295.1:14167:41642:1 gene:ENSXETG00000015025 transcript:ENSXETT00000065118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFDDLTTCAVPEVPENGYRTQSMGIFFENAVVRFHCKSGYKLKGPSKKMCVQLYNGSLAW
KPSDTPVCLQEVTDCLAPYVEDADILNKTYKTGDKLIMSCRDGFQTRYPDLDNMASICQD
DGTWDNLAMCQGCLRPLVQPHSYINISEFDFSFPVGRVVYYQCFPGYKLEGAEYIECMYN
LIWSAEPPRCLDVEVCPLPPMVTHGDYTCHPQPCDRYNHGTVIEFFCDPGYTLANDYKYF
TCQSGEWFPSYPVMCIKTEASWPNTEDTLLTTWKIVAFTASTVLLVLLLVIIARSFQTKF
KTHFLPRKSPQDSTGEPDFVVVDGVLVMLPSYDEAVSSAVNITPPGYTPSAGQRSPTPTD
ESHPPAYPGIPGNTDSLCEESETFDSLLDSSELAQTLHSASLSHVRAASAENATNGEAPS
TSPSIDIADEIPLMDEEP
Download sequence
Identical sequences F6S5D4
ENSXETP00000058546 ENSXETP00000032866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]