SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000058603 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000058603
Domain Number 1 Region: 157-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000096
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 66-154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000518
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 256-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000565
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000058603   Gene: ENSXETG00000032963   Transcript: ENSXETT00000060414
Sequence length 392
Comment pep:novel scaffold:JGI_4.2:GL172727.1:3054990:3061185:1 gene:ENSXETG00000032963 transcript:ENSXETT00000060414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKHGIKIHTEETNENDVKHVISTSAQGAAGNYSCTYWTKISGRNMKSLLSNTLEIRITTI
CFAAHPPAPSISLSPSHSVYIVGEHVTLSCYPPDSYKAKGIQYFHEGKEIHSTTHVIYTE
VRSSAGNYSCGYWIETHNRNINSMASDYVTIVITNILPPPSISLNPFHSIYIRGETVTLT
CSVPDGCVANQIQYYQHGRVVQARLTDERTVMFVISTNNAEVAGNYSCSYTTTKFSRSIN
SSVSSSVTIRIADKPRPPSIILRPSHPVYLKGEFINMTCSIYNHSIMTKVQFYKDENQIQ
VEEAHDGEATYRLFLAGLEATGHFLCKYMIIVSGREILSEPSRRIQVTVMGYTRGTNIVL
HLAAAAVVLISFIIVLALEAKQNVPTPTPSSS
Download sequence
Identical sequences F6YZ82
ENSXETP00000058603 ENSXETP00000064002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]