SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000058798 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000058798
Domain Number 1 Region: 41-166,209-317
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-30
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000058798   Gene: ENSXETG00000031105   Transcript: ENSXETT00000060495
Sequence length 320
Comment pep:known_by_projection scaffold:JGI_4.2:GL173626.1:184564:199612:1 gene:ENSXETG00000031105 transcript:ENSXETT00000060495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADKEMRGQNSRQLQKRKDPAGKGETGKARKEIKKFIQANAKNDPKFQDLQTFLIDWINAE
LKEEHIVVKSVEEDLYDGLVLHHLLKKIAGMKLEVEEIALWASSQKRKLGVIMEAITQSL
QLQETDLKWSLNEIHNKDLLCTLHLIVALAQHFRPDLELPANVGVEVIRVEPTRNGMKTE
NVIEFITGSSNFPAEPDAFDHLFEQSPEKVEDVKKAIVNFVNKHLANLSLTVTDPESQFA
DGVILLLLIGQLEGYFMNLGSSHTDPDLLLPHVHNVSLALELLLEGGIIQNPMDPADIVN
GDLKATLRLLYSLFLRHKRR
Download sequence
Identical sequences F7C4P8
ENSXETP00000058798 ENSXETP00000058798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]