SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059345 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000059345
Domain Number - Region: 25-53
Classification Level Classification E-value
Superfamily Plexin repeat 0.0136
Family Plexin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059345   Gene: ENSXETG00000013285   Transcript: ENSXETT00000061086
Sequence length 166
Comment pep:known scaffold:JGI_4.2:GL172854.1:1328874:1339971:-1 gene:ENSXETG00000013285 transcript:ENSXETT00000061086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPERCVSLFVCVLLGLATAMAADTECFLMNNTSCDKCLQNVKCLWCNTDSKCVDYPVKN
VLPPSSLCKLRDARWGVCWVNFEAMIIAMSVVGGSLIFALIICCCCCCRKKKPRNTGLED
EREAREKEQRRTRQEERRAEMKTRHDEIRKKYDFFKETASVRRGEK
Download sequence
Identical sequences F6Z4F7
ENSXETP00000044210 ENSXETP00000059345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]