SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059488 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059488
Domain Number 1 Region: 745-859
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-32
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059488   Gene: ENSXETG00000016155   Transcript: ENSXETT00000064447
Sequence length 870
Comment pep:known scaffold:JGI_4.2:GL172727.1:1256487:1332904:-1 gene:ENSXETG00000016155 transcript:ENSXETT00000064447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIRQSSERDNGKLVCKSQDAVGNLVPSLAQEREDLEERQKIRAQIHELRSAQNGGSHIA
GSKEIESNMLLRLKVPTKEQLPSSTSSSSSTSSFTSFSSEPSSSSHCQATELLSLSAEFE
GQPHNNRNEVFMEPSAEDSGTETREQPNTHVASHKQNVKSEQKPLPVWTGRADSHIISRL
GADNKESFPEGVTSASCSEPDDQTSMPPFRRAYSVRDRVKKFSEETSSVTTPALGFRFGS
MRAERAPVRGAHVLQQHSLLSVGQENNQKAAQNARFVTKQEVTRTVSGPCTRRLDGIPTA
GTQSTNKIQSFKSPFIPELNNSRSTSLKGSSSLSSTGPCTSSREVNRGLPQSQGSFILKQ
NSGRSQENQLKVPLPMTERGRIDENSDGANTEGPGSLQSSTHLCKSTKGTREETEDTDMK
TLLTIEIKDGRNQTTSSRVVGQPGNQRAELMLGLTSSPFRINSGFSTSNDGASSGITTRS
IRTETRTTTQSGITSSSNVIKVEAETPQETPQQLEVFLPSTTEKAEPENKGKLTAEDLNA
IEEEEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQREKEREQRLQELKNKERESKLAR
STETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTK
SSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMKAQSLPKTPATQARKAMI
EKMEKESGGSSSPAFAKVATPRSAAFGVPNANSIKQMLLDWCKAKTRGYEHVNIQNFSSS
WSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGK
RPDSKCVFTYVQSLYNHLRRHEMRLRKSEF
Download sequence
Identical sequences F6QVD7
ENSXETP00000059488 ENSXETP00000059488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]