SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059514 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059514
Domain Number 1 Region: 152-296
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.23e-25
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 30-148
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.21e-24
Family ADP-ribosylating toxins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059514   Gene: ENSXETG00000032410   Transcript: ENSXETT00000062021
Sequence length 316
Comment pep:novel scaffold:JGI_4.2:GL172675.1:3843588:3868772:1 gene:ENSXETG00000032410 transcript:ENSXETT00000062021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSVGIFESSLQKRAVINFSMHYKIILQSNAQPRDGKIYVMYHGTTLAAAIQIIQNGFKQS
ADGMLGRGVYVSRDMDKAARYPLRDQSQQVILKLRVNVGKVKMINYQGHPLQKTWHDHGY
DTAWVPASCGMVPSQLEEDCIWDPKRIKVVGIAKIFKENISEQYNHLFLQSNHHPRDRNI
YVMYHGTTVAAATQIIKHGFKQSADGMLGRGVYVSRDKDKAARYPLDDQSDQVVLKLRVN
VGRVKKIDCQGHPLQKTWHDHGYDTAWVPSCSGMVPSQLEEDCIWDPRRIKVVWISKAPK
NHLSHLIKLFKKHIKN
Download sequence
Identical sequences F6QDG6
ENSXETP00000061884 ENSXETP00000059514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]