SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059601 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059601
Domain Number 1 Region: 382-504
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.15e-20
Family Mannose 6-phosphate receptor domain 0.0071
Further Details:      
 
Domain Number 2 Region: 212-259
Classification Level Classification E-value
Superfamily EF-hand 0.0000151
Family Calmodulin-like 0.059
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000059601
Domain Number - Region: 73-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000608
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 39-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000681
Family LDL receptor-like module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059601   Gene: ENSXETG00000016744   Transcript: ENSXETT00000061780
Sequence length 517
Comment pep:known scaffold:JGI_4.2:GL173084.1:161138:170742:1 gene:ENSXETG00000016744 transcript:ENSXETT00000061780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMKALLLLLLVGVLGCWAVEVKRPRGVSLSNRAFYDDSKPFTCLDGSRTIPFDRVNDDYC
DCADGTDEPETAKACSNGRFHCTNAGYKPQYIPSSRINDGICDCCDTTDEYNSGALCENT
CREMGKKEREELQMAAEIAREGFRVKQLLIEDARKGREEKQTKLQDMVQRRQALQSQVDA
LRLQKEEAEKPEQEAKDAHQKAWEEHKEAEKAEEDKQRSLEVFTELDQDSDGMLAASELR
SHMELDVDGDGAMSDEEAQSLLGDTSVDVGIFQESVWPQIREKFKSETDAQAVPPIEEPT
ESHPEPEEDIRVMNQPDSPFPILTVTARREGVLSVPPSKAQEAEPEMPPYDEVTQALIDA
AQTARSTYEEAEKSLRDMEDTIKGLEKEISLDFGPTGEFSYLYGECYELSTSEYVYRLCP
FNRVTQKPKHGGSETNLGSWGSWAGPEDNKFSFMKFEHGTSCWQGPNRSTLVKLSCGKDS
ILTSTSEPSRCEYLMEFFTPAACHPPPEVLPDDHDEL
Download sequence
Identical sequences F6PN96
ENSXETP00000059601 ENSXETP00000059601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]